Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5359
Gene name
LocationContig_268:20852..24355
Strand+
Gene length (bp)3503
Transcript length (bp)3162
Coding sequence length (bp)3162
Protein length (aa) 1054

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08101 DUF1708 Domain of unknown function (DUF1708) 4.0E-171 44 511

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P21339|MSB1_YEAST Morphogenesis-related protein MSB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSB1 PE=1 SV=1 47 345 3.0E-31
sp|Q10326|MUG8_SCHPO Meiotically up-regulated gene 8 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug8 PE=1 SV=1 37 648 2.0E-14

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 49 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5359
MPGLFSRLKGRDGVKSKKKNAVDNSLGSQPLKPMWEDAYARKTVEPEEIHELLHYCTSELKARGLDIPFLLLPFR
PTSNPSAVRTFVRHFFDHNYSLRGDMLLQELRMTEPMVISGVVKWCWSRLSGGVVGWDAYELFKVGEYDSNRARD
SFKTFIPISVENGAKQRIIFDFFDLIAAIAAHGKSNGFGGQKLSRMASWWAFEYSDTGNGFDGGYKMWLSAADAT
SHLFFAYLRSLSPEQNLTGISMLPRSLEKLLRETEYPPPRPHQMMSITNKLAMVVDVVSPTPFSLLRRAGHFQYR
DSDIGLQEFANYDDPVQALTEECLRVLKAISAANQSHVSSIKHSTSLRDASWSRFEDIGFASPLDEDEADDDGPP
ATRPTQGIRSTPASGTNLARPTTPSWADFLSSGFNDENPHRSNLLLPPDKAIPPLESQIRQQQSSQSHRPRLEQE
RNLEPGELASITVVELDDAFWWVWMNSLAPEETADRKSAFGRCAVIETTIGSARWIVVEEMVVGAAPAPEEGAYI
AEKKRFFSWTKRGKTMSRRKSMAKKAQTQTNAHAANKAAAGKPTVGAETHARIQAKAAQLRAMKDHEQQAAAAEA
ASSQRRGRTDAELIAEKTNSIFTLQPNIAGEASSAMKWVKKYDKGAIKDAYLANTNAGRGVAVSPAPSDHMMTDS
PNGTSIHEPAAPQVPAKDPLPASVASPRSPLRPADSPTPEPEHQDPRSSSVRAASTGVGASERESAERSASPLPP
LPSSTEASMAAHDVTMSEPKVSTERAKLHKNMHQGTKTKTGGLRKLKLFGRKNRSSKLPENAPADLNKMLPPERP
AVAPVVQQTPTPAATPPPARDSMASAPPLPEPDTPNEAKAPSPPPHEPDTPKSLPPAADPEQGTGEEHAPEAANG
EELSHIDTQDAAEANREFSRFDQGPLTDQPAFIPDDDQDEDDATPPPIARHPTHQEAPKAGADKKTLEELSHSAS
PGVQDRWAQIRKNAAQRAATRQTEAPPRMATGKAAEGDEDTSGEETIESRVARIKARVAELTGNMGEANAAQTVP
RAR*
Coding >Hirsu2|5359
ATGCCCGGCCTCTTCTCTCGCCTCAAGGGCCGAGATGGCGTCAAGTCCAAGAAGAAGAATGCCGTCGACAACTCG
CTCGGCTCGCAGCCGCTGAAGCCCATGTGGGAGGACGCCTACGCACGCAAGACGGTTGAGCCGGAAGAAATCCAC
GAGCTTCTGCATTACTGCACCTCCGAGCTCAAGGCTCGCGGCCTCGACATCCCCTTTCTCCTCCTGCCATTCCGA
CCGACTTCGAACCCGAGCGCCGTGCGGACCTTCGTCAGGCACTTCTTCGACCACAACTACTCTTTGCGGGGCGAT
ATGCTGCTTCAGGAGCTGCGCATGACCGAGCCCATGGTCATATCCGGCGTTGTAAAATGGTGTTGGAGTCGTCTC
TCGGGCGGTGTCGTAGGCTGGGATGCCTATGAACTATTCAAGGTCGGCGAATATGATTCGAATCGAGCCCGCGAC
TCCTTCAAAACCTTCATTCCGATCAGTGTCGAAAACGGCGCCAAGCAGCGCATCATTTTCGACTTCTTTGACTTG
ATCGCCGCCATTGCCGCCCACGGCAAGTCCAACGGCTTTGGCGGCCAAAAGCTGTCCCGCATGGCCTCGTGGTGG
GCCTTCGAGTACAGCGACACCGGCAACGGCTTCGACGGCGGATACAAAATGTGGCTGAGTGCTGCCGATGCCACG
AGCCATCTCTTCTTCGCCTACCTCAGGTCTCTGTCTCCCGAGCAGAACTTGACGGGCATCTCCATGCTCCCGAGA
TCGCTCGAGAAACTGCTGAGGGAGACGGAGTATCCGCCGCCCAGGCCCCATCAGATGATGTCCATCACCAACAAG
CTGGCCATGGTCGTCGACGTCGTCTCGCCCACTCCCTTTTCGCTGCTGCGACGGGCAGGCCACTTCCAGTATCGC
GACTCGGACATCGGCCTTCAGGAGTTCGCCAACTACGACGATCCGGTCCAGGCTCTGACCGAGGAGTGTCTCCGC
GTGCTCAAGGCCATTTCCGCCGCCAACCAGTCGCATGTTTCTAGCATCAAGCACTCGACGAGCTTGCGTGACGCG
TCCTGGTCGCGTTTCGAGGACATTGGCTTCGCCAGCCCCTTGGACGAGGACGAGGCTGACGATGACGGCCCGCCA
GCCACACGACCGACCCAAGGCATCCGGAGCACCCCGGCATCAGGCACCAACCTGGCTCGGCCGACGACTCCCTCG
TGGGCCGACTTCCTGTCGTCCGGCTTCAACGACGAGAACCCCCATCGATCGAACCTGCTTCTCCCCCCCGACAAG
GCTATCCCGCCGCTGGAGAGCCAGATCAGGCAGCAGCAGAGCTCGCAATCCCATCGACCGCGTCTGGAGCAGGAG
CGCAACCTCGAACCCGGCGAGCTCGCAAGCATCACCGTCGTCGAGTTGGACGACGCCTTTTGGTGGGTGTGGATG
AACAGCCTCGCCCCTGAAGAGACGGCCGACCGAAAGTCGGCCTTTGGCCGATGTGCCGTCATCGAGACGACGATC
GGCAGCGCCAGGTGGATCGTCGTCGAGGAGATGGTTGTCGGCGCTGCCCCCGCGCCCGAGGAGGGAGCCTATATT
GCCGAGAAGAAGAGATTCTTCAGCTGGACCAAGCGGGGAAAGACCATGTCTCGACGGAAATCCATGGCCAAGAAG
GCCCAGACCCAGACCAACGCCCACGCCGCGAACAAGGCGGCCGCCGGGAAGCCGACCGTCGGCGCCGAAACCCAC
GCCAGGATCCAGGCCAAGGCGGCACAGCTGCGCGCCATGAAAGATCACGAACAGCAGGCGGCTGCGGCCGAGGCG
GCAAGCTCGCAGCGTCGCGGCCGCACCGATGCGGAACTGATCGCGGAAAAAACTAACAGCATCTTCACCCTTCAG
CCCAACATCGCCGGCGAGGCCTCGTCTGCCATGAAGTGGGTCAAGAAGTACGACAAGGGCGCTATTAAGGATGCG
TACCTGGCCAACACCAACGCCGGGCGTGGTGTTGCCGTGTCTCCGGCGCCGTCCGACCACATGATGACTGACTCT
CCGAACGGCACTTCCATCCACGAGCCGGCCGCACCGCAAGTGCCCGCAAAGGATCCGTTGCCGGCGTCAGTTGCG
TCCCCCCGGTCGCCCTTGCGTCCTGCCGACTCCCCGACTCCGGAGCCCGAGCACCAAGATCCACGCTCGTCTTCG
GTCAGGGCGGCCTCTACGGGCGTCGGCGCCTCGGAGCGAGAAAGCGCGGAACGGAGCGCCAGCCCGCTGCCTCCC
CTCCCATCGAGCACCGAGGCCTCGATGGCGGCCCACGATGTGACCATGTCTGAGCCCAAGGTCTCCACCGAGAGG
GCCAAGCTGCACAAGAACATGCATCAGGGCACCAAGACGAAGACTGGCGGCCTCCGGAAGCTGAAGCTTTTTGGC
CGCAAGAACCGATCGTCCAAGCTCCCGGAGAATGCGCCGGCCGACCTGAACAAGATGCTGCCGCCCGAGAGGCCG
GCCGTGGCGCCTGTTGTGCAGCAGACCCCGACGCCCGCCGCCACCCCGCCCCCGGCCCGGGACAGCATGGCTTCC
GCACCTCCGCTTCCCGAGCCAGACACGCCGAACGAGGCCAAGGCCCCTTCGCCGCCCCCTCACGAGCCGGACACG
CCCAAGTCCCTGCCTCCCGCTGCTGACCCAGAGCAGGGAACCGGGGAGGAGCACGCACCGGAAGCTGCCAACGGC
GAAGAGCTCTCGCATATCGACACGCAAGACGCTGCCGAGGCCAACCGCGAGTTTTCGCGCTTCGATCAAGGGCCC
TTGACGGATCAGCCTGCGTTCATTCCCGACGACGATCAGGACGAGGACGATGCCACTCCGCCGCCCATTGCTCGT
CATCCCACGCATCAGGAGGCGCCCAAGGCGGGGGCGGATAAGAAGACGCTCGAAGAACTGAGCCACAGTGCCAGT
CCTGGAGTGCAGGACCGTTGGGCGCAGATTCGCAAGAATGCTGCGCAAAGGGCCGCGACGCGTCAAACTGAGGCG
CCCCCGCGCATGGCCACCGGCAAGGCAGCCGAGGGCGACGAAGATACCAGCGGAGAAGAGACGATCGAATCCCGC
GTCGCTCGCATCAAGGCCCGCGTCGCCGAGCTGACGGGCAACATGGGCGAAGCTAACGCCGCGCAGACAGTGCCT
CGAGCTCGCTAG
Transcript >Hirsu2|5359
ATGCCCGGCCTCTTCTCTCGCCTCAAGGGCCGAGATGGCGTCAAGTCCAAGAAGAAGAATGCCGTCGACAACTCG
CTCGGCTCGCAGCCGCTGAAGCCCATGTGGGAGGACGCCTACGCACGCAAGACGGTTGAGCCGGAAGAAATCCAC
GAGCTTCTGCATTACTGCACCTCCGAGCTCAAGGCTCGCGGCCTCGACATCCCCTTTCTCCTCCTGCCATTCCGA
CCGACTTCGAACCCGAGCGCCGTGCGGACCTTCGTCAGGCACTTCTTCGACCACAACTACTCTTTGCGGGGCGAT
ATGCTGCTTCAGGAGCTGCGCATGACCGAGCCCATGGTCATATCCGGCGTTGTAAAATGGTGTTGGAGTCGTCTC
TCGGGCGGTGTCGTAGGCTGGGATGCCTATGAACTATTCAAGGTCGGCGAATATGATTCGAATCGAGCCCGCGAC
TCCTTCAAAACCTTCATTCCGATCAGTGTCGAAAACGGCGCCAAGCAGCGCATCATTTTCGACTTCTTTGACTTG
ATCGCCGCCATTGCCGCCCACGGCAAGTCCAACGGCTTTGGCGGCCAAAAGCTGTCCCGCATGGCCTCGTGGTGG
GCCTTCGAGTACAGCGACACCGGCAACGGCTTCGACGGCGGATACAAAATGTGGCTGAGTGCTGCCGATGCCACG
AGCCATCTCTTCTTCGCCTACCTCAGGTCTCTGTCTCCCGAGCAGAACTTGACGGGCATCTCCATGCTCCCGAGA
TCGCTCGAGAAACTGCTGAGGGAGACGGAGTATCCGCCGCCCAGGCCCCATCAGATGATGTCCATCACCAACAAG
CTGGCCATGGTCGTCGACGTCGTCTCGCCCACTCCCTTTTCGCTGCTGCGACGGGCAGGCCACTTCCAGTATCGC
GACTCGGACATCGGCCTTCAGGAGTTCGCCAACTACGACGATCCGGTCCAGGCTCTGACCGAGGAGTGTCTCCGC
GTGCTCAAGGCCATTTCCGCCGCCAACCAGTCGCATGTTTCTAGCATCAAGCACTCGACGAGCTTGCGTGACGCG
TCCTGGTCGCGTTTCGAGGACATTGGCTTCGCCAGCCCCTTGGACGAGGACGAGGCTGACGATGACGGCCCGCCA
GCCACACGACCGACCCAAGGCATCCGGAGCACCCCGGCATCAGGCACCAACCTGGCTCGGCCGACGACTCCCTCG
TGGGCCGACTTCCTGTCGTCCGGCTTCAACGACGAGAACCCCCATCGATCGAACCTGCTTCTCCCCCCCGACAAG
GCTATCCCGCCGCTGGAGAGCCAGATCAGGCAGCAGCAGAGCTCGCAATCCCATCGACCGCGTCTGGAGCAGGAG
CGCAACCTCGAACCCGGCGAGCTCGCAAGCATCACCGTCGTCGAGTTGGACGACGCCTTTTGGTGGGTGTGGATG
AACAGCCTCGCCCCTGAAGAGACGGCCGACCGAAAGTCGGCCTTTGGCCGATGTGCCGTCATCGAGACGACGATC
GGCAGCGCCAGGTGGATCGTCGTCGAGGAGATGGTTGTCGGCGCTGCCCCCGCGCCCGAGGAGGGAGCCTATATT
GCCGAGAAGAAGAGATTCTTCAGCTGGACCAAGCGGGGAAAGACCATGTCTCGACGGAAATCCATGGCCAAGAAG
GCCCAGACCCAGACCAACGCCCACGCCGCGAACAAGGCGGCCGCCGGGAAGCCGACCGTCGGCGCCGAAACCCAC
GCCAGGATCCAGGCCAAGGCGGCACAGCTGCGCGCCATGAAAGATCACGAACAGCAGGCGGCTGCGGCCGAGGCG
GCAAGCTCGCAGCGTCGCGGCCGCACCGATGCGGAACTGATCGCGGAAAAAACTAACAGCATCTTCACCCTTCAG
CCCAACATCGCCGGCGAGGCCTCGTCTGCCATGAAGTGGGTCAAGAAGTACGACAAGGGCGCTATTAAGGATGCG
TACCTGGCCAACACCAACGCCGGGCGTGGTGTTGCCGTGTCTCCGGCGCCGTCCGACCACATGATGACTGACTCT
CCGAACGGCACTTCCATCCACGAGCCGGCCGCACCGCAAGTGCCCGCAAAGGATCCGTTGCCGGCGTCAGTTGCG
TCCCCCCGGTCGCCCTTGCGTCCTGCCGACTCCCCGACTCCGGAGCCCGAGCACCAAGATCCACGCTCGTCTTCG
GTCAGGGCGGCCTCTACGGGCGTCGGCGCCTCGGAGCGAGAAAGCGCGGAACGGAGCGCCAGCCCGCTGCCTCCC
CTCCCATCGAGCACCGAGGCCTCGATGGCGGCCCACGATGTGACCATGTCTGAGCCCAAGGTCTCCACCGAGAGG
GCCAAGCTGCACAAGAACATGCATCAGGGCACCAAGACGAAGACTGGCGGCCTCCGGAAGCTGAAGCTTTTTGGC
CGCAAGAACCGATCGTCCAAGCTCCCGGAGAATGCGCCGGCCGACCTGAACAAGATGCTGCCGCCCGAGAGGCCG
GCCGTGGCGCCTGTTGTGCAGCAGACCCCGACGCCCGCCGCCACCCCGCCCCCGGCCCGGGACAGCATGGCTTCC
GCACCTCCGCTTCCCGAGCCAGACACGCCGAACGAGGCCAAGGCCCCTTCGCCGCCCCCTCACGAGCCGGACACG
CCCAAGTCCCTGCCTCCCGCTGCTGACCCAGAGCAGGGAACCGGGGAGGAGCACGCACCGGAAGCTGCCAACGGC
GAAGAGCTCTCGCATATCGACACGCAAGACGCTGCCGAGGCCAACCGCGAGTTTTCGCGCTTCGATCAAGGGCCC
TTGACGGATCAGCCTGCGTTCATTCCCGACGACGATCAGGACGAGGACGATGCCACTCCGCCGCCCATTGCTCGT
CATCCCACGCATCAGGAGGCGCCCAAGGCGGGGGCGGATAAGAAGACGCTCGAAGAACTGAGCCACAGTGCCAGT
CCTGGAGTGCAGGACCGTTGGGCGCAGATTCGCAAGAATGCTGCGCAAAGGGCCGCGACGCGTCAAACTGAGGCG
CCCCCGCGCATGGCCACCGGCAAGGCAGCCGAGGGCGACGAAGATACCAGCGGAGAAGAGACGATCGAATCCCGC
GTCGCTCGCATCAAGGCCCGCGTCGCCGAGCTGACGGGCAACATGGGCGAAGCTAACGCCGCGCAGACAGTGCCT
CGAGCTCGCTAG
Gene >Hirsu2|5359
ATGCCCGGCCTCTTCTCTCGCCTCAAGGGCCGAGATGGCGTCAAGTCCAAGAAGAAGAATGCCGTCGACAACTCG
CTCGGCTCGCAGCCGCTGAAGCCCATGTGGGAGGACGCCTACGCACGCAAGACGGTTGAGCCGGAAGAAATCCAC
GAGCTTCTGCATTACTGCACCTCCGAGCTCAAGGCTCGCGGTATGCCCTTCCCCGCTGCCCGCGACATCACGTCT
CGACTGACTGCCCGTGCCTCCCCCCAGGCCTCGACATCCCCTTTCTCCTCCTGCCATTCCGACCGACTTCGAACC
CGAGCGCCGTGCGGACCTTCGTCAGGCACTTCTTCGACCACAACTACTCTTTGCGGGGCGATATGCTGCTTCAGG
AGCTGCGCATGACCGAGCCCATGGTGAGCAGCTTGCCCGCTTCCGACCCGGCTCCACGCTGATGCAGCCTTGCTA
TAGGTCATATCCGGCGTTGTAAAATGGTGTTGGAGTCGTCTCTCGGGCGGTGTCGTAGGCTGGGATGCCTATGAA
CTATTCAAGGTCGGCGAATATGGTACGTGACGTGCGCTGGCAGCTCCTCTAGGCGTCGCCGCCCGCCTCGCCGCG
TGCATGAGACTCATTATGCGTCAGATTCGAATCGAGCCCGCGACTCCTTCAAAACCTTCATTCCGATCAGTGTCG
AAAACGGCGCCAAGCAGCGCATCATTTTCGACTTCTTTGACTTGATCGCCGCCATTGCCGCCCACGGCAAGTCCA
ACGGCTTTGGCGGCCAAAAGCTGTCCCGCATGGCCTCGTGGTGGGCCTTCGAGTACAGCGACACCGGCAACGGCT
TCGACGGCGGATACAAAATGTGGCTGAGGTCAGACTGGGCTGCTTCTCGTCGCCGCACGGCGCCATCCCCCGCCC
CCGGCTAACGTGCGATGCAGTGCTGCCGATGCCACGAGCCATCTCTTCTTCGCCTACCTCAGGTCTCTGTCTCCC
GAGCAGAACTTGACGGGCATCTCCATGCTCCCGAGATCGCTCGAGAAACTGCTGAGGGAGACGGAGTATCCGCCG
CCCAGGCCCCATCAGATGATGTCCATCACCAACAAGCTGGCCATGGTCGTCGACGTCGTCTCGCCCACTCCCTTT
TCGCTGCTGCGACGGGCAGGCCACTTCCAGTATCGCGACTCGGACATCGGCCTTCAGGAGTTCGCCAACTACGAC
GATCCGGTCCAGGCTCTGACCGAGGAGTGTCTCCGCGTGCTCAAGGCCATTTCCGCCGCCAACCAGTCGCATGTT
TCTAGCATCAAGCACTCGACGAGCTTGCGTGACGCGTCCTGGTCGCGTTTCGAGGACATTGGCTTCGCCAGCCCC
TTGGACGAGGACGAGGCTGACGATGACGGCCCGCCAGCCACACGACCGACCCAAGGCATCCGGAGCACCCCGGCA
TCAGGCACCAACCTGGCTCGGCCGACGACTCCCTCGTGGGCCGACTTCCTGTCGTCCGGCTTCAACGACGAGAAC
CCCCATCGATCGAACCTGCTTCTCCCCCCCGACAAGGCTATCCCGCCGCTGGAGAGCCAGATCAGGCAGCAGCAG
AGCTCGCAATCCCATCGACCGCGTCTGGAGCAGGAGCGCAACCTCGAACCCGGCGAGCTCGCAAGCATCACCGTC
GTCGAGTTGGACGACGCCTTTTGGTGGGTGTGGATGAACAGCCTCGCCCCTGAAGAGACGGCCGACCGAAAGTCG
GCCTTTGGCCGATGTGCCGTCATCGAGACGACGATCGGCAGCGCCAGGTGGATCGTCGTCGAGGAGATGGTTGTC
GGCGCTGCCCCCGCGCCCGAGGAGGGAGCCTATATTGCCGAGAAGAAGAGATTCTTCAGCTGGACCAAGCGGGGA
AAGACCATGTCTCGACGGAAATCCATGGCCAAGAAGGCCCAGACCCAGACCAACGCCCACGCCGCGAACAAGGCG
GCCGCCGGGAAGCCGACCGTCGGCGCCGAAACCCACGCCAGGATCCAGGCCAAGGCGGCACAGCTGCGCGCCATG
AAAGATCACGAACAGCAGGCGGCTGCGGCCGAGGCGGCAAGCTCGCAGCGTCGCGGCCGCACCGATGCGGAACTG
ATCGCGGAAAAAACTAACAGCATCTTCACCCTTCAGCCCAACATCGCCGGCGAGGCCTCGTCTGCCATGAAGTGG
GTCAAGAAGTACGACAAGGGCGCTATTAAGGATGCGTACCTGGCCAACACCAACGCCGGGCGTGGTGTTGCCGTG
TCTCCGGCGCCGTCCGACCACATGATGACTGACTCTCCGAACGGCACTTCCATCCACGAGCCGGCCGCACCGCAA
GTGCCCGCAAAGGATCCGTTGCCGGCGTCAGTTGCGTCCCCCCGGTCGCCCTTGCGTCCTGCCGACTCCCCGACT
CCGGAGCCCGAGCACCAAGATCCACGCTCGTCTTCGGTCAGGGCGGCCTCTACGGGCGTCGGCGCCTCGGAGCGA
GAAAGCGCGGAACGGAGCGCCAGCCCGCTGCCTCCCCTCCCATCGAGCACCGAGGCCTCGATGGCGGCCCACGAT
GTGACCATGTCTGAGCCCAAGGTCTCCACCGAGAGGGCCAAGCTGCACAAGAACATGCATCAGGGCACCAAGACG
AAGACTGGCGGCCTCCGGAAGCTGAAGCTTTTTGGCCGCAAGAACCGATCGTCCAAGCTCCCGGAGAATGCGCCG
GCCGACCTGAACAAGATGCTGCCGCCCGAGAGGCCGGCCGTGGCGCCTGTTGTGCAGCAGACCCCGACGCCCGCC
GCCACCCCGCCCCCGGCCCGGGACAGCATGGCTTCCGCACCTCCGCTTCCCGAGCCAGACACGCCGAACGAGGCC
AAGGCCCCTTCGCCGCCCCCTCACGAGCCGGACACGCCCAAGTCCCTGCCTCCCGCTGCTGACCCAGAGCAGGGA
ACCGGGGAGGAGCACGCACCGGAAGCTGCCAACGGCGAAGAGCTCTCGCATATCGACACGCAAGACGCTGCCGAG
GCCAACCGCGAGTTTTCGCGCTTCGATCAAGGGCCCTTGACGGATCAGCCTGCGTTCATTCCCGACGACGATCAG
GACGAGGACGATGCCACTCCGCCGCCCATTGCTCGTCATCCCACGCATCAGGAGGCGCCCAAGGCGGGGGCGGAT
AAGAAGACGCTCGAAGAACTGAGCCACAGTGCCAGTCCTGGAGTGCAGGACCGTTGGGCGCAGATTCGCAAGAAT
GCTGCGCAAAGGGCCGCGACGCGTCAAACTGAGGCGCCCCCGCGCATGGCCACCGGCAAGGCAGCCGAGGGCGAC
GAAGATACCAGCGGAGAAGAGAGTACGCGTCCCCTTGATATCCACGGGTGGAAGAGGGAGCGGTCCCTCGTGTCT
GGCGGGTTTTGCTGACTGCATGTCCAGCGATCGAATCCCGCGTCGCTCGCATCAAGGCCCGCGTCGCCGAGCTGA
CGGGCAACATGGGCGAAGCTAACGCCGCGCAGACAGTGCCTCGAGCTCGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail