Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5354
Gene name
LocationContig_268:2779..5505
Strand-
Gene length (bp)2726
Transcript length (bp)2517
Coding sequence length (bp)2517
Protein length (aa) 839

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08238 Sel1 Sel1 repeat 1.3E-01 139 171
PF08238 Sel1 Sel1 repeat 2.4E-06 179 214
PF08238 Sel1 Sel1 repeat 3.1E+01 219 247
PF08238 Sel1 Sel1 repeat 3.4E-03 320 348
PF08238 Sel1 Sel1 repeat 2.2E-02 380 410
PF08238 Sel1 Sel1 repeat 1.7E-02 411 446
PF08238 Sel1 Sel1 repeat 2.8E+00 449 482
PF08238 Sel1 Sel1 repeat 1.7E+02 484 511
PF08238 Sel1 Sel1 repeat 4.1E-02 616 642
PF08238 Sel1 Sel1 repeat 2.3E-03 652 680

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UBV2|SE1L1_HUMAN Protein sel-1 homolog 1 OS=Homo sapiens GN=SEL1L PE=1 SV=3 126 702 3.0E-78
sp|Q9ESM7|SE1L1_MESAU Protein sel-1 homolog 1 OS=Mesocricetus auratus GN=Sel1l PE=2 SV=1 126 729 1.0E-75
sp|Q5TEA6|SE1L2_HUMAN Protein sel-1 homolog 2 OS=Homo sapiens GN=SEL1L2 PE=1 SV=2 129 702 2.0E-75
sp|Q80Z70|SE1L1_RAT Protein sel-1 homolog 1 OS=Rattus norvegicus GN=Sel1l PE=2 SV=2 126 702 6.0E-75
sp|Q3V172|SE1L2_MOUSE Protein sel-1 homolog 2 OS=Mus musculus GN=Sel1l2 PE=2 SV=1 126 702 8.0E-75
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UBV2|SE1L1_HUMAN Protein sel-1 homolog 1 OS=Homo sapiens GN=SEL1L PE=1 SV=3 126 702 3.0E-78
sp|Q9ESM7|SE1L1_MESAU Protein sel-1 homolog 1 OS=Mesocricetus auratus GN=Sel1l PE=2 SV=1 126 729 1.0E-75
sp|Q5TEA6|SE1L2_HUMAN Protein sel-1 homolog 2 OS=Homo sapiens GN=SEL1L2 PE=1 SV=2 129 702 2.0E-75
sp|Q80Z70|SE1L1_RAT Protein sel-1 homolog 1 OS=Rattus norvegicus GN=Sel1l PE=2 SV=2 126 702 6.0E-75
sp|Q3V172|SE1L2_MOUSE Protein sel-1 homolog 2 OS=Mus musculus GN=Sel1l2 PE=2 SV=1 126 702 8.0E-75
sp|Q9Z2G6|SE1L1_MOUSE Protein sel-1 homolog 1 OS=Mus musculus GN=Sel1l PE=1 SV=2 126 702 9.0E-75
sp|Q5XI05|SE1L2_RAT Protein sel-1 homolog 2 OS=Rattus norvegicus GN=Sel1l2 PE=2 SV=1 126 702 3.0E-74
sp|Q9LM25|HRD3A_ARATH ERAD-associated E3 ubiquitin-protein ligase component HRD3A OS=Arabidopsis thaliana GN=HRD3A PE=1 SV=1 152 794 2.0E-62
sp|O13875|YE1A_SCHPO Uncharacterized Sel1-like repeat-containing protein C1B3.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1B3.10c PE=3 SV=4 126 706 6.0E-55
sp|Q10NT7|HRD3_ORYSJ ERAD-associated E3 ubiquitin-protein ligase component HRD3 OS=Oryza sativa subsp. japonica GN=HRD3 PE=2 SV=1 189 740 2.0E-51
sp|Q9C6B6|HRD3B_ARATH ERAD-associated E3 ubiquitin-protein ligase component HRD3B OS=Arabidopsis thaliana GN=HRD3B PE=3 SV=1 174 727 9.0E-47
sp|Q6FNV5|HRD3_CANGA ERAD-associated E3 ubiquitin-protein ligase component HRD3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HRD3 PE=3 SV=1 125 704 4.0E-45
sp|Q05787|HRD3_YEAST ERAD-associated E3 ubiquitin-protein ligase component HRD3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HRD3 PE=1 SV=1 129 732 8.0E-41
sp|Q9USV0|HRD3_SCHPO Putative ERAD-associated E3 ubiquitin-protein ligase component OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC28F2.08c PE=3 SV=1 175 704 3.0E-30
sp|A0A0H2VDN9|ESIB_ECOL6 Secretory immunoglobulin A-binding protein EsiB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=esiB PE=1 SV=1 174 646 5.0E-17
sp|Q68CR1|SE1L3_HUMAN Protein sel-1 homolog 3 OS=Homo sapiens GN=SEL1L3 PE=1 SV=2 174 714 3.0E-15
sp|Q80TS8|SE1L3_MOUSE Protein sel-1 homolog 3 OS=Mus musculus GN=Sel1l3 PE=2 SV=3 174 714 1.0E-14
sp|A0A0H2VDN9|ESIB_ECOL6 Secretory immunoglobulin A-binding protein EsiB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=esiB PE=1 SV=1 127 516 8.0E-12
sp|P77234|YBEQ_ECOLI Uncharacterized protein YbeQ OS=Escherichia coli (strain K12) GN=ybeQ PE=4 SV=2 464 687 8.0E-08
sp|P77234|YBEQ_ECOLI Uncharacterized protein YbeQ OS=Escherichia coli (strain K12) GN=ybeQ PE=4 SV=2 175 439 8.0E-08
sp|Q9LM25|HRD3A_ARATH ERAD-associated E3 ubiquitin-protein ligase component HRD3A OS=Arabidopsis thaliana GN=HRD3A PE=1 SV=1 81 406 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 770 789 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5354
MRSPAVWLLLLCQAAVVLSTNAQYYHETHNDRAVRRDAKGHGLGPKPDAAEEQAQPTVREPGADLVDAAVEELRK
VPRPPRGRRRQPSSLLASAFRHILKTIPTGPAAAPAQEKPSRGAGGPLLSAVEMLQQAARHNNSDALYLLAELNF
FGNYSHPRNLEAAFDHYRRLAHGTGNTTAQYMLGLYHSTGIGGVVPRDQARALLYYTFAAARGDTRAEMATAFRH
HGGIGAVKDCETAVRYYKRVADKAINWYRSGPPGGMSWVQQGWRIADDVGGIYGEGASVSSSGINSRKASPHSDA
HAAIGDVIEYLDLVSQKGDSKASYNLGRIYYEGQRGLDKDFELARKYFFVVASRYWKRDNRVVESYTKETEKMAA
KAAGYIGRMYLRGDGVAQNFDRAKIWFDRGVSLGDAQSQYGRGLMLLDGHGGKEKNVKLAMELFASSANQDFAPA
QVQMGRLYLDQGGPDDVRIANNHFELAARHGNMEAHYYLAEMVHNGVGREKLCGMALSYYKTVAEKAEPLVSSWA
DANEAYEAGDYDLALLEYLMAAEQGFEKAQTNVAYMLDTFRARSSLSLSLSSWLGGGPRPREADEGGPRLLDDPG
LALVYWTRSSRQANIDALVKMGDYYFYGIGTERDVGKAVLCYTGASDYSQSAQALFNLGWMHENGIGLTQDFHLA
KRYYDNALEVNEEAYLPVTLSLLKLRVRSAWNTLTHGPIHSIQDEPKKGKEWSLSEWIANFLEDDNLLYEDEMYD
EDGFEGTIGAGDEGMGDGGVVESVLIIGITMVLVLLLWWRQRMQQAHALADEERRRNAGQHPAPAAQQGDEAEAG
ADGFREWAAGGGI*
Coding >Hirsu2|5354
ATGAGGAGCCCGGCCGTGTGGCTGCTCCTGCTTTGCCAGGCCGCCGTCGTGCTGAGCACGAACGCGCAATACTAT
CACGAAACACACAACGACCGAGCCGTCCGACGCGATGCCAAGGGCCATGGCCTCGGCCCCAAGCCAGACGCGGCC
GAGGAGCAAGCCCAGCCCACGGTCCGGGAACCCGGTGCCGACCTCGTCGACGCCGCCGTCGAAGAGCTCCGCAAG
GTGCCTCGCCCACCGCGCGGCCGACGGCGACAGCCATCCAGCCTGCTCGCCTCGGCCTTCCGCCACATCCTCAAG
ACGATCCCGACCGGCCCCGCCGCCGCGCCGGCCCAGGAAAAGCCGTCGAGGGGCGCGGGAGGCCCGCTGCTGAGC
GCCGTCGAGATGCTCCAGCAGGCCGCCCGGCACAACAACTCGGACGCGCTCTACCTGCTGGCCGAGCTCAACTTC
TTCGGCAACTACAGCCACCCGCGGAACCTCGAGGCCGCCTTCGACCACTACCGCCGGCTGGCGCACGGCACCGGC
AACACGACGGCCCAGTACATGCTGGGCCTCTACCACTCGACCGGCATCGGCGGCGTCGTCCCCCGCGACCAGGCC
AGGGCCCTGCTCTACTACACCTTCGCCGCCGCCCGGGGCGACACGCGCGCCGAGATGGCCACGGCCTTTCGGCAT
CATGGCGGCATCGGCGCCGTTAAGGACTGCGAGACGGCCGTCAGGTACTACAAGCGCGTGGCCGACAAGGCCATC
AACTGGTACCGCTCGGGGCCCCCGGGCGGCATGTCGTGGGTCCAGCAGGGCTGGCGCATCGCCGACGACGTGGGC
GGCATCTACGGCGAGGGCGCCAGCGTCTCCAGCTCCGGCATCAACTCGCGCAAGGCCAGCCCGCACTCGGACGCC
CACGCCGCCATCGGCGACGTCATCGAGTACCTCGACCTCGTCTCCCAAAAGGGCGACTCCAAGGCGTCCTACAAC
CTCGGCCGCATCTACTACGAGGGGCAGCGCGGCCTCGACAAAGACTTCGAACTGGCGCGCAAGTACTTCTTCGTC
GTCGCCTCGCGCTACTGGAAGCGCGACAACCGCGTGGTCGAGAGCTACACCAAGGAGACGGAGAAGATGGCGGCC
AAGGCGGCCGGCTACATCGGCCGTATGTACCTGCGCGGCGACGGCGTCGCCCAGAACTTCGACCGGGCCAAGATC
TGGTTCGACCGCGGCGTCTCGCTCGGCGACGCCCAGTCGCAGTACGGCCGCGGCCTGATGCTGCTCGACGGCCAC
GGCGGCAAGGAGAAGAACGTCAAGCTGGCCATGGAGCTGTTCGCCTCGTCCGCCAACCAGGACTTCGCCCCGGCG
CAGGTCCAGATGGGCCGGCTGTACCTGGACCAGGGCGGCCCGGACGACGTGCGCATCGCCAACAACCACTTCGAG
CTCGCGGCCCGGCACGGCAACATGGAGGCGCACTACTACCTGGCCGAGATGGTGCACAACGGGGTCGGGCGGGAG
AAGCTGTGCGGCATGGCGCTGAGCTACTATAAGACGGTGGCGGAGAAGGCGGAGCCGCTGGTGTCGTCGTGGGCC
GACGCCAACGAGGCGTACGAGGCCGGCGACTACGACCTCGCCCTGCTCGAGTACCTGATGGCGGCCGAGCAGGGC
TTCGAGAAGGCGCAGACCAACGTGGCCTACATGCTCGATACGTTCCGCGCGCGGTCGTCGCTCTCGCTCTCGCTC
TCGAGCTGGCTGGGCGGCGGGCCGAGGCCGCGTGAGGCGGACGAGGGCGGGCCGCGGCTGCTGGACGACCCAGGC
CTGGCGCTCGTCTACTGGACGCGGTCGTCGCGGCAGGCCAACATCGACGCGCTCGTCAAGATGGGCGACTACTAC
TTCTACGGCATCGGGACGGAGCGCGACGTGGGCAAGGCGGTGCTGTGCTACACGGGCGCGTCGGACTACTCGCAG
AGCGCGCAGGCCCTCTTCAACCTGGGCTGGATGCACGAGAACGGGATCGGACTGACGCAGGACTTCCACCTGGCC
AAGCGCTACTACGACAACGCGCTCGAGGTGAACGAGGAGGCCTACCTGCCCGTGACGCTGAGCCTGCTGAAGCTG
CGGGTGCGCAGCGCCTGGAACACGCTGACCCACGGGCCCATCCACTCGATCCAGGACGAGCCGAAGAAGGGCAAG
GAATGGTCGCTCTCGGAGTGGATCGCCAACTTCTTGGAAGACGACAACCTGCTGTACGAAGACGAGATGTACGAC
GAGGACGGCTTCGAGGGCACGATCGGGGCCGGGGACGAGGGCATGGGGGACGGAGGTGTAGTGGAGAGCGTGCTG
ATCATCGGCATCACCATGGTGCTGGTGCTGCTGCTGTGGTGGCGGCAGCGGATGCAGCAGGCGCACGCGCTGGCG
GACGAGGAGAGGCGGCGGAACGCGGGGCAGCACCCGGCGCCGGCGGCGCAGCAGGGCGACGAGGCCGAGGCCGGC
GCCGACGGCTTCCGCGAGTGGGCGGCGGGCGGGGGCATATAG
Transcript >Hirsu2|5354
ATGAGGAGCCCGGCCGTGTGGCTGCTCCTGCTTTGCCAGGCCGCCGTCGTGCTGAGCACGAACGCGCAATACTAT
CACGAAACACACAACGACCGAGCCGTCCGACGCGATGCCAAGGGCCATGGCCTCGGCCCCAAGCCAGACGCGGCC
GAGGAGCAAGCCCAGCCCACGGTCCGGGAACCCGGTGCCGACCTCGTCGACGCCGCCGTCGAAGAGCTCCGCAAG
GTGCCTCGCCCACCGCGCGGCCGACGGCGACAGCCATCCAGCCTGCTCGCCTCGGCCTTCCGCCACATCCTCAAG
ACGATCCCGACCGGCCCCGCCGCCGCGCCGGCCCAGGAAAAGCCGTCGAGGGGCGCGGGAGGCCCGCTGCTGAGC
GCCGTCGAGATGCTCCAGCAGGCCGCCCGGCACAACAACTCGGACGCGCTCTACCTGCTGGCCGAGCTCAACTTC
TTCGGCAACTACAGCCACCCGCGGAACCTCGAGGCCGCCTTCGACCACTACCGCCGGCTGGCGCACGGCACCGGC
AACACGACGGCCCAGTACATGCTGGGCCTCTACCACTCGACCGGCATCGGCGGCGTCGTCCCCCGCGACCAGGCC
AGGGCCCTGCTCTACTACACCTTCGCCGCCGCCCGGGGCGACACGCGCGCCGAGATGGCCACGGCCTTTCGGCAT
CATGGCGGCATCGGCGCCGTTAAGGACTGCGAGACGGCCGTCAGGTACTACAAGCGCGTGGCCGACAAGGCCATC
AACTGGTACCGCTCGGGGCCCCCGGGCGGCATGTCGTGGGTCCAGCAGGGCTGGCGCATCGCCGACGACGTGGGC
GGCATCTACGGCGAGGGCGCCAGCGTCTCCAGCTCCGGCATCAACTCGCGCAAGGCCAGCCCGCACTCGGACGCC
CACGCCGCCATCGGCGACGTCATCGAGTACCTCGACCTCGTCTCCCAAAAGGGCGACTCCAAGGCGTCCTACAAC
CTCGGCCGCATCTACTACGAGGGGCAGCGCGGCCTCGACAAAGACTTCGAACTGGCGCGCAAGTACTTCTTCGTC
GTCGCCTCGCGCTACTGGAAGCGCGACAACCGCGTGGTCGAGAGCTACACCAAGGAGACGGAGAAGATGGCGGCC
AAGGCGGCCGGCTACATCGGCCGTATGTACCTGCGCGGCGACGGCGTCGCCCAGAACTTCGACCGGGCCAAGATC
TGGTTCGACCGCGGCGTCTCGCTCGGCGACGCCCAGTCGCAGTACGGCCGCGGCCTGATGCTGCTCGACGGCCAC
GGCGGCAAGGAGAAGAACGTCAAGCTGGCCATGGAGCTGTTCGCCTCGTCCGCCAACCAGGACTTCGCCCCGGCG
CAGGTCCAGATGGGCCGGCTGTACCTGGACCAGGGCGGCCCGGACGACGTGCGCATCGCCAACAACCACTTCGAG
CTCGCGGCCCGGCACGGCAACATGGAGGCGCACTACTACCTGGCCGAGATGGTGCACAACGGGGTCGGGCGGGAG
AAGCTGTGCGGCATGGCGCTGAGCTACTATAAGACGGTGGCGGAGAAGGCGGAGCCGCTGGTGTCGTCGTGGGCC
GACGCCAACGAGGCGTACGAGGCCGGCGACTACGACCTCGCCCTGCTCGAGTACCTGATGGCGGCCGAGCAGGGC
TTCGAGAAGGCGCAGACCAACGTGGCCTACATGCTCGATACGTTCCGCGCGCGGTCGTCGCTCTCGCTCTCGCTC
TCGAGCTGGCTGGGCGGCGGGCCGAGGCCGCGTGAGGCGGACGAGGGCGGGCCGCGGCTGCTGGACGACCCAGGC
CTGGCGCTCGTCTACTGGACGCGGTCGTCGCGGCAGGCCAACATCGACGCGCTCGTCAAGATGGGCGACTACTAC
TTCTACGGCATCGGGACGGAGCGCGACGTGGGCAAGGCGGTGCTGTGCTACACGGGCGCGTCGGACTACTCGCAG
AGCGCGCAGGCCCTCTTCAACCTGGGCTGGATGCACGAGAACGGGATCGGACTGACGCAGGACTTCCACCTGGCC
AAGCGCTACTACGACAACGCGCTCGAGGTGAACGAGGAGGCCTACCTGCCCGTGACGCTGAGCCTGCTGAAGCTG
CGGGTGCGCAGCGCCTGGAACACGCTGACCCACGGGCCCATCCACTCGATCCAGGACGAGCCGAAGAAGGGCAAG
GAATGGTCGCTCTCGGAGTGGATCGCCAACTTCTTGGAAGACGACAACCTGCTGTACGAAGACGAGATGTACGAC
GAGGACGGCTTCGAGGGCACGATCGGGGCCGGGGACGAGGGCATGGGGGACGGAGGTGTAGTGGAGAGCGTGCTG
ATCATCGGCATCACCATGGTGCTGGTGCTGCTGCTGTGGTGGCGGCAGCGGATGCAGCAGGCGCACGCGCTGGCG
GACGAGGAGAGGCGGCGGAACGCGGGGCAGCACCCGGCGCCGGCGGCGCAGCAGGGCGACGAGGCCGAGGCCGGC
GCCGACGGCTTCCGCGAGTGGGCGGCGGGCGGGGGCATATAG
Gene >Hirsu2|5354
ATGAGGAGCCCGGCCGTGTGGCTGCTCCGTACGTGGCCCGGCCCTCGCTGCCTCGACGCCGTCCGGCTGACCGAC
GCGCAGTGCTTTGCCAGGCCGCCGTCGTGCTGAGCACGAACGCGCAATACTATCACGAAACACACAACGACCGAG
CCGTCCGACGCGATGCCAAGGGCCATGGCCTCGGCCCCAAGCCAGACGCGGCCGAGGAGCAAGCCCAGCCCACGG
TCCGGGAACCCGGTTAGTTTCCGACGCCCGCCCTCCTCCGACGCCATGTGCGAGATGCTGATGCGGCAAAACCCG
GCCCAACAGGTGCCGACCTCGTCGACGCCGCCGTCGAAGAGCTCCGCAAGGTGCCTCGCCCACCGCGCGGCCGAC
GGCGACAGCCATCCAGCCTGCTCGCCTCGGCCTTCCGCCACATCCTCAAGACGATCCCGACCGGCCCCGCCGCCG
CGCCGGCCCAGGAAAAGCCGTCGAGGGGCGCGGGAGGCCCGCTGCTGAGCGCCGTCGAGATGCTCCAGCAGGCCG
CCCGGCACAACAACTCGGACGCGCTCTACCTGCTGGCCGAGCTCAACTTCTTCGGCAACTACAGCCACCCGCGGA
ACCTCGAGGCCGCCTTCGACCACTACCGCCGGCTGGCGCACGGCACCGGCAACACGACGGCCCAGTACATGCTGG
GCCTCTACCACTCGACCGGCATCGGCGGCGTCGTCCCCCGCGACCAGGCCAGGGCCCTGCTCTACTACACCTTCG
CCGCCGCCCGGGGCGACACGCGCGCCGAGATGGCCACGGCCTTTCGGCATCATGGCGGCATCGGCGCCGTTAAGG
ACTGCGAGACGGCCGTCAGGTACTACAAGCGCGTGGCCGACAAGGCCATCAACTGGTACCGCTCGGGGCCCCCGG
GCGGCATGTCGTGGGTCCAGCAGGGCTGGCGCATCGCCGACGACGTGGGCGGCATCTACGGCGAGGGCGCCAGCG
TCTCCAGCTCCGGCATCAACTCGCGCAAGGCCAGCCCGCACTCGGACGCCCACGCCGCCATCGGCGACGTCATCG
AGTACCTCGACCTCGTCTCCCAAAAGGGCGACTCCAAGGCGTCCTACAACCTCGGCCGCATCTACTACGAGGGGC
AGCGCGGCCTCGACAAAGACTTCGAACTGGCGCGCAAGTACTTCTTCGTCGTCGCCTCGCGCTACTGGAAGCGCG
ACAACCGCGTGGTCGAGAGCTACACCAAGGAGACGGAGAAGATGGCGGCCAAGGCGGCCGGCTACATCGGCCGTA
TGTACCTGCGCGGCGACGGCGTCGCCCAGAACTTCGACCGGGCCAAGATCTGGTTCGACCGCGGCGTCTCGCTCG
GCGACGCCCAGTCGCAGTACGGCCGCGGCCTGATGCTGCTCGACGGCCACGGCGGCAAGGAGAAGAACGTCAAGC
TGGCCATGGAGCTGTTCGCCTCGTCCGCCAACCAGGACTTCGCCCCGGCGCAGGTCCAGATGGGCCGGCTGTACC
TGGACCAGGGCGGCCCGGACGACGTGCGCATCGCCAACAACCACTTCGAGCTCGCGGCCCGGCACGGCAACATGG
AGGCGCACTACTACCTGGCCGAGATGGTGCACAACGGGGTCGGGCGGGAGAAGCTGTGCGGCATGGCGCTGAGCT
ACTATAAGACGGTGGCGGAGAAGGCGGAGCCGCTGGTGTCGTCGTGGGCCGACGCCAACGAGGCGTACGAGGCCG
GCGACTACGACCTCGCCCTGCTCGAGTACCTGATGGCGGCCGAGCAGGGCTTCGAGAAGGCGCAGACCAACGTGG
CCTACATGCTCGATACGTTCCGCGCGCGGTCGTCGCTCTCGCTCTCGCTCTCGAGCTGGCTGGGCGGCGGGCCGA
GGCCGCGTGAGGCGGACGAGGGCGGGCCGCGGCTGCTGGACGACCCAGGCCTGGCGCTCGTCTACTGGACGCGGT
CGTCGCGGCAGGCCAACATCGACGCGCTCGTCAAGATGGGCGACTACTACTTCTACGGCATCGGGACGGAGCGCG
ACGTGGGCAAGGCGGTGCTGTGCTACACGGGCGCGTCGGACTACTCGCAGAGCGCGCAGGCCCTCTTCAACCTGG
GCTGGATGCACGAGAACGGGATCGGACTGACGCAGGACTTCCACCTGGCCAAGCGCTACTACGACAACGCGCTCG
AGGTGAACGAGGAGGCCTACCTGCCCGTGACGCTGAGCCTGCTGAAGCTGCGGGTGCGCAGCGCCTGGAACACGC
TGACCCACGGGCCCATCCACTCGATCCAGGACGAGCCGAGTAAGTGATGACGACACCACCGGTCGTTCCCCCACC
CCCGCCCCTGATGCAGTGATGCTGACTTCCGTTTCTCCTTCGCTTCAGAGAAGGGCAAGGAATGGTCGCTCTCGG
AGTGGATCGCCAACTTCTTGGAAGACGACAACCTGCTGTACGAAGACGAGATGTACGACGAGGACGGCTTCGAGG
GCACGATCGGGGCCGGGGACGAGGGCATGGGGGACGGAGGTGTAGTGGAGAGCGTGCTGATCATCGGCATCACCA
TGGTGCTGGTGCTGCTGCTGTGGTGGCGGCAGCGGATGCAGCAGGCGCACGCGCTGGCGGACGAGGAGAGGCGGC
GGAACGCGGGGCAGCACCCGGCGCCGGCGGCGCAGCAGGGCGACGAGGCCGAGGCCGGCGCCGACGGCTTCCGCG
AGTGGGCGGCGGGCGGGGGCATATAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail