Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5349
Gene name
LocationContig_2676:128..2118
Strand+
Gene length (bp)1990
Transcript length (bp)1416
Coding sequence length (bp)1416
Protein length (aa) 472

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03169 OPT OPT oligopeptide transporter protein 1.9E-126 3 468

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40900|ISP4_SCHPO Sexual differentiation process protein isp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp4 PE=2 SV=2 1 468 3.0E-148
sp|O14031|PGT1_SCHPO Glutathione transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgt1 PE=1 SV=1 1 465 2.0E-119
sp|P40897|OPT1_YEAST Oligopeptide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT1 PE=1 SV=1 7 467 1.0E-112
sp|Q9SUA4|OPT5_ARATH Oligopeptide transporter 5 OS=Arabidopsis thaliana GN=OPT5 PE=2 SV=1 1 468 2.0E-103
sp|Q9FG72|OPT1_ARATH Oligopeptide transporter 1 OS=Arabidopsis thaliana GN=OPT1 PE=2 SV=1 1 468 2.0E-103
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40900|ISP4_SCHPO Sexual differentiation process protein isp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp4 PE=2 SV=2 1 468 3.0E-148
sp|O14031|PGT1_SCHPO Glutathione transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgt1 PE=1 SV=1 1 465 2.0E-119
sp|P40897|OPT1_YEAST Oligopeptide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT1 PE=1 SV=1 7 467 1.0E-112
sp|Q9SUA4|OPT5_ARATH Oligopeptide transporter 5 OS=Arabidopsis thaliana GN=OPT5 PE=2 SV=1 1 468 2.0E-103
sp|Q9FG72|OPT1_ARATH Oligopeptide transporter 1 OS=Arabidopsis thaliana GN=OPT1 PE=2 SV=1 1 468 2.0E-103
sp|O82485|OPT7_ARATH Oligopeptide transporter 7 OS=Arabidopsis thaliana GN=OPT7 PE=2 SV=1 1 468 3.0E-100
sp|O04514|OPT2_ARATH Oligopeptide transporter 2 OS=Arabidopsis thaliana GN=OPT2 PE=2 SV=2 1 468 2.0E-98
sp|Q9FJD1|OPT8_ARATH Oligopeptide transporter 8 OS=Arabidopsis thaliana GN=OPT8 PE=2 SV=1 2 468 3.0E-98
sp|Q9T095|OPT6_ARATH Oligopeptide transporter 6 OS=Arabidopsis thaliana GN=OPT6 PE=2 SV=1 1 468 4.0E-97
sp|Q9FJD2|OPT9_ARATH Oligopeptide transporter 9 OS=Arabidopsis thaliana GN=OPT9 PE=2 SV=1 1 468 3.0E-95
sp|Q9FME8|OPT4_ARATH Oligopeptide transporter 4 OS=Arabidopsis thaliana GN=OPT4 PE=1 SV=1 1 468 4.0E-94
sp|O23482|OPT3_ARATH Oligopeptide transporter 3 OS=Arabidopsis thaliana GN=OPT3 PE=2 SV=3 1 466 9.0E-92
sp|Q06593|OPT2_YEAST Oligopeptide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT2 PE=1 SV=1 1 464 4.0E-70
sp|Q7LL00|YQJC_SCHPO Uncharacterized oligopeptide transporter C1840.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1840.12 PE=3 SV=2 1 467 5.0E-69
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.5

Transmembrane Domains

Domain # Start End Length
1 9 28 19
2 33 55 22
3 110 132 22
4 136 158 22
5 179 201 22
6 221 243 22
7 250 272 22
8 327 349 22
9 379 401 22
10 405 427 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5349
LPCSTVRAWVIGLTLVVVGASTNTLFSLRQPSISIGPLVGQIIAWPLGHAWARLVPDRRFRTFGRRWSLNPGPFN
IKEHSVIGVMASVSFSVAYSTDLILAQLVFYKQNFGLAFQFLLTVSTQSLGYGIAGIMRKFLVYPASMIWPGILV
AVTLMNVMYEQNDRPNPAIIGGSMPRYRWFLLVTVASFFYYFIPGFLAQCLSVFAFATWLAPQNAVVNQLFGGTT
GLSLVPITFDWTQIAGWVGSPLIPPWYAIANVLIGVVVFYVLGSSVLHYSGAWYAQFLPMSDPNTYDNTGRPYNT
TRVLNEDFTLNEEAFRNYSPLFISTTFALSYGLAFAAISSLVVHTFLHYRKQIWRQYRNSTSEKPDIHMKLMRRY
REAPTWWYMSLFVTMLVLGLYTVLAYPTQLSWWAFLLAVLISYGFALPIGIIEAVTNNQIGLNVLTEFVYGYIQP
GRPLALMIFKTFGYITISGTT*
Coding >Hirsu2|5349
CTGCCGTGCAGCACCGTGCGCGCCTGGGTCATCGGCCTGACGCTCGTCGTCGTCGGCGCCTCGACCAACACGCTC
TTCTCGCTGCGGCAGCCGTCCATCTCGATCGGGCCGCTCGTCGGCCAGATCATCGCCTGGCCGCTCGGCCACGCC
TGGGCGCGCCTCGTGCCGGACCGCCGCTTCCGCACCTTTGGCCGCCGCTGGAGCCTCAACCCGGGCCCCTTCAAC
ATCAAGGAGCACAGCGTCATCGGCGTCATGGCCAGCGTCTCCTTCTCCGTCGCCTACTCCACCGACCTCATCCTC
GCCCAGCTGGTCTTCTACAAGCAGAACTTCGGCCTCGCCTTCCAGTTCCTGCTGACCGTCTCGACCCAGTCGCTC
GGCTACGGCATCGCCGGCATCATGCGCAAGTTCCTAGTGTATCCGGCGTCCATGATCTGGCCCGGCATCCTCGTC
GCCGTCACGCTCATGAACGTCATGTACGAGCAAAACGACCGGCCCAACCCGGCCATCATCGGCGGCTCCATGCCG
CGCTACCGCTGGTTCCTCCTCGTCACCGTCGCCTCCTTCTTCTACTACTTCATCCCCGGCTTCCTGGCCCAGTGC
CTCAGCGTCTTCGCCTTCGCCACCTGGCTCGCGCCGCAGAACGCCGTCGTGAACCAGCTCTTCGGCGGCACCACC
GGCCTGTCGCTCGTTCCCATCACCTTTGACTGGACCCAGATTGCCGGCTGGGTCGGCTCGCCCCTGATCCCGCCT
TGGTACGCCATCGCCAATGTCCTCATCGGCGTCGTCGTCTTCTACGTCCTCGGCTCGTCCGTCCTGCACTACTCG
GGCGCCTGGTACGCGCAGTTCTTGCCCATGAGCGACCCCAACACGTACGACAACACGGGCCGGCCCTACAACACG
ACGCGCGTCCTCAACGAAGACTTTACCCTCAACGAGGAGGCCTTCCGGAACTACTCTCCGCTCTTCATCAGCACG
ACGTTTGCCCTTTCGTACGGGCTCGCCTTTGCCGCGATCTCGTCCCTGGTCGTCCACACCTTTCTGCACTACCGC
AAGCAGATCTGGCGACAGTACCGAAACAGCACGAGCGAGAAGCCCGACATCCACATGAAGCTCATGCGCAGGTAC
AGGGAGGCACCGACCTGGTGGTACATGTCTCTCTTCGTCACCATGCTCGTGCTCGGCCTCTACACCGTCCTGGCC
TACCCGACCCAGCTGAGCTGGTGGGCCTTCCTGCTGGCCGTGCTCATCTCGTACGGATTCGCCCTGCCGATCGGC
ATCATCGAGGCCGTCACCAACAACCAGATCGGCCTCAACGTCCTCACCGAGTTCGTCTACGGATACATCCAGCCG
GGTAGGCCCCTGGCGCTCATGATCTTCAAGACGTTCGGATACATCACCATTTCGGGCACTACATGA
Transcript >Hirsu2|5349
CTGCCGTGCAGCACCGTGCGCGCCTGGGTCATCGGCCTGACGCTCGTCGTCGTCGGCGCCTCGACCAACACGCTC
TTCTCGCTGCGGCAGCCGTCCATCTCGATCGGGCCGCTCGTCGGCCAGATCATCGCCTGGCCGCTCGGCCACGCC
TGGGCGCGCCTCGTGCCGGACCGCCGCTTCCGCACCTTTGGCCGCCGCTGGAGCCTCAACCCGGGCCCCTTCAAC
ATCAAGGAGCACAGCGTCATCGGCGTCATGGCCAGCGTCTCCTTCTCCGTCGCCTACTCCACCGACCTCATCCTC
GCCCAGCTGGTCTTCTACAAGCAGAACTTCGGCCTCGCCTTCCAGTTCCTGCTGACCGTCTCGACCCAGTCGCTC
GGCTACGGCATCGCCGGCATCATGCGCAAGTTCCTAGTGTATCCGGCGTCCATGATCTGGCCCGGCATCCTCGTC
GCCGTCACGCTCATGAACGTCATGTACGAGCAAAACGACCGGCCCAACCCGGCCATCATCGGCGGCTCCATGCCG
CGCTACCGCTGGTTCCTCCTCGTCACCGTCGCCTCCTTCTTCTACTACTTCATCCCCGGCTTCCTGGCCCAGTGC
CTCAGCGTCTTCGCCTTCGCCACCTGGCTCGCGCCGCAGAACGCCGTCGTGAACCAGCTCTTCGGCGGCACCACC
GGCCTGTCGCTCGTTCCCATCACCTTTGACTGGACCCAGATTGCCGGCTGGGTCGGCTCGCCCCTGATCCCGCCT
TGGTACGCCATCGCCAATGTCCTCATCGGCGTCGTCGTCTTCTACGTCCTCGGCTCGTCCGTCCTGCACTACTCG
GGCGCCTGGTACGCGCAGTTCTTGCCCATGAGCGACCCCAACACGTACGACAACACGGGCCGGCCCTACAACACG
ACGCGCGTCCTCAACGAAGACTTTACCCTCAACGAGGAGGCCTTCCGGAACTACTCTCCGCTCTTCATCAGCACG
ACGTTTGCCCTTTCGTACGGGCTCGCCTTTGCCGCGATCTCGTCCCTGGTCGTCCACACCTTTCTGCACTACCGC
AAGCAGATCTGGCGACAGTACCGAAACAGCACGAGCGAGAAGCCCGACATCCACATGAAGCTCATGCGCAGGTAC
AGGGAGGCACCGACCTGGTGGTACATGTCTCTCTTCGTCACCATGCTCGTGCTCGGCCTCTACACCGTCCTGGCC
TACCCGACCCAGCTGAGCTGGTGGGCCTTCCTGCTGGCCGTGCTCATCTCGTACGGATTCGCCCTGCCGATCGGC
ATCATCGAGGCCGTCACCAACAACCAGATCGGCCTCAACGTCCTCACCGAGTTCGTCTACGGATACATCCAGCCG
GGTAGGCCCCTGGCGCTCATGATCTTCAAGACGTTCGGATACATCACCATTTCGGGCACTACATGA
Gene >Hirsu2|5349
CTGCCGTGCAGCACCGTGCGCGCCTGGGTCATCGGCCTGACGCTCGTCGTCGTCGGCGCCTCGACCAACACGCTC
TTCTCGCTGCGGCAGCCGTCCATCTCGATCGGGCCGCTCGTCGGCCAGATCATCGCCTGGCCGCTCGGCCACGCC
TGGGCGCGCCTCGTGCCGGACCGCCGCTTCCGCACCTTTGGCCGCCGCTGGAGCCTCAACCCGGGCCCCTTCAAC
ATCAAGGAGCACAGCGTCATCGGCGTCATGGCCAGCGTCTCCTTCTCCGTCGCCTACTCCACCGACCTCATCCTC
GCCCAGCTGGTCTTCTACAAGCAGAACTTCGGCCTCGCCTTCCAGTTCCTGCTGACCGTCTCGACCCAGTCGCTC
GGCTACGGCATCGCCGGCATCATGCGCAAGTTCCTAGGTGAGGCCCTCGCGCGCCCTCGAGCCACCCCCCTTTTT
TCCCCTTCGCCCTCCCCCGCCTCTCTCGTGCCTTTGCTGTTTCCGACTCCTCCCGTTCAACAAGGCTCGATCCAG
CTGACACGGCCGTGTCGCCAAAGTGTATCCGGCGTCCATGATCTGGCCCGGCATCCTCGTCGCCGTCACGCTCAT
GAACGTCATGTACGAGCAAAACGACCGGCCCAACCCGGCCATCATCGGCGGCTCCATGCCGCGCTACCGCTGGTT
CCTCCTCGTCACCGTCGCCTCCTTCTTCTACTACTTCATCCCCGGCTTCCTGGCCCAGTGCCTCAGCGTCTTCGC
CTTCGCCACCTGGCTCGCGCCGCAGAACGCCGTCGTGAACCAGCTCTTCGGCGGCACCACCGGCCTGTCGCTCGT
TCCCATCACCTTTGACTGGACCCAGATTGCCGGCTGGGTCGGCTCGCCCCTGATCCCGCCTTGGTACGCGTGCCC
CCTCCCCCCCCCCTCCCTTTCTCGTCGTGTCTCGTCTGTGTGCTGAGCCTCGCCCAGGTACGCCATCGCCAATGT
CCTCATCGGCGTCGTCGTCTTCTACGTCCTCGGCTCGTCCGTCCTGCACTACTCGGGCGCCTGGTACGCGCAGTT
CTTGCCCATGAGCGACCCCAACACGTACGACAACACGGGCCGGCCCTACAACACGACGCGCGTCCTCAACGAAGA
CTTTACCCTCAACGAGGAGGCCTTCCGGAACTACTCTCCGCTCTTCATCAGGTTCCTCTCCCCGAACCCCCTCTC
TCCGCTTCCTCCCCCTCCCCCCTAGCTGACGGGATAGCAGCACGACGTTTGCCCTTTCGTACGGGCTCGCCTTTG
CCGCGATCTCGTCCCTGGTCGTCCACACCTTTCTGCACTACCGCAAGCAGATCTGGCGACAGTACCGAAACAGCA
CGAGCGAGAAGCCCGACATCCACATGAAGCTCATGCGCAGGTACAGGGAGGCACCGACCTGGTGGTACATGTCTC
TCTTCGTCACCGTCAGTCTCGTCCTCGGGCACCGTCCAAAAGGGCTGTCGCACATCACGCACGATGGAACCTCGT
TCGCTGACCTCGGCCCGCCNNNNNNNNNNNNNNNNNCCCCCCCCCCCCCCCCCGTTCCAGATGCTCGTGCTCGGC
CTCTACACCGTCCTGGCCTACCCGACCCAGCTGAGCTGGTGGGCCTTCCTGCTGGCCGTGCTCATCTCGTACGGA
TTCGCCCTGCCGATCGGCATCATCGAGGCCGTCACCAACAACCAGATCGGCCTCAACGTCCTCACCGAGTTCGTC
TACGGATACATCCAGCCGGGTAGGCCCCTGGCGCTCATGATGCAAGTTCTCCCCCTTCCTCCACCCAACGGCCGA
CCCTGGCAGTCCTCCGGGGCACATGGGACTGACAGACGGAGCTGCAGCTTCAAGACGTTCGGATACATCACCATG
TCAGTCGGCCCCCCCTTCCTCTGGTCCCTCCGCGAGCGGCGGTCAACTGACTGCCGCTGCCCCAGGTCGCAAGCG
CTGCGCTTCGTCGCGGACCTCAAGTTCGGGCACTACATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail