Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5347
Gene name
LocationContig_2674:792..1651
Strand+
Gene length (bp)859
Transcript length (bp)693
Coding sequence length (bp)693
Protein length (aa) 231

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00505 HMG_box HMG (high mobility group) box 1.7E-15 15 67

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CY17|MATMC_SCHPO Mating-type M-specific polypeptide Mc OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mat1-Mc PE=2 SV=1 15 73 2.0E-11
sp|C7U331|MATMC_SCHPM Mating-type M-specific polypeptide Mc OS=Schizosaccharomyces pombe GN=mat3-Mc PE=2 SV=1 15 73 2.0E-11
sp|Q6WRX6|MATMC_SCHKA Mating-type M-specific polypeptide Mc OS=Schizosaccharomyces kambucha GN=matMc PE=3 SV=1 15 73 2.0E-11
sp|P0CY16|MTMC3_SCHPO Silenced mating-type M-specific polypeptide Mc OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mat3-Mc PE=3 SV=1 15 73 2.0E-11
sp|Q08143|SMR2_PODAS Sporulation minus regulator 2 OS=Podospora anserina GN=SMR2 PE=3 SV=1 15 83 5.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CY17|MATMC_SCHPO Mating-type M-specific polypeptide Mc OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mat1-Mc PE=2 SV=1 15 73 2.0E-11
sp|C7U331|MATMC_SCHPM Mating-type M-specific polypeptide Mc OS=Schizosaccharomyces pombe GN=mat3-Mc PE=2 SV=1 15 73 2.0E-11
sp|Q6WRX6|MATMC_SCHKA Mating-type M-specific polypeptide Mc OS=Schizosaccharomyces kambucha GN=matMc PE=3 SV=1 15 73 2.0E-11
sp|P0CY16|MTMC3_SCHPO Silenced mating-type M-specific polypeptide Mc OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mat3-Mc PE=3 SV=1 15 73 2.0E-11
sp|Q08143|SMR2_PODAS Sporulation minus regulator 2 OS=Podospora anserina GN=SMR2 PE=3 SV=1 15 83 5.0E-09
sp|P43267|SOX15_MOUSE Protein SOX-15 OS=Mus musculus GN=Sox15 PE=1 SV=3 16 75 8.0E-09
sp|Q5A220|RFG1_CANAL Repressor of filamentous growth 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RFG1 PE=2 SV=2 7 72 3.0E-08
sp|P25042|ROX1_YEAST Repressor ROX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROX1 PE=1 SV=1 26 72 1.0E-07
sp|Q870J1|STE11_PNECA HMG-box protein STE11 OS=Pneumocystis carinii PE=1 SV=1 29 72 6.0E-07
sp|Q864Q4|SRY_MESST Sex-determining region Y protein OS=Mesoplodon stejnegeri GN=SRY PE=3 SV=1 16 120 2.0E-06
sp|O60248|SOX15_HUMAN Protein SOX-15 OS=Homo sapiens GN=SOX15 PE=1 SV=1 16 75 2.0E-06
sp|Q03256|SRY_CAPHI Sex-determining region Y protein OS=Capra hircus GN=SRY PE=3 SV=2 16 85 3.0E-06
sp|Q8AXQ4|SOX12_XENLA Transcription factor Sox-12 OS=Xenopus laevis GN=sox12 PE=2 SV=1 22 77 4.0E-06
sp|Q8SPQ2|SRY_BISBI Sex-determining region Y protein OS=Bison bison GN=SRY PE=3 SV=1 16 77 5.0E-06
sp|Q863D9|SRY_ALCAC Sex-determining region Y protein OS=Alces alces cameloides GN=SRY PE=3 SV=1 16 77 5.0E-06
sp|Q27949|SRY_BISBO Sex-determining region Y protein OS=Bison bonasus GN=SRY PE=3 SV=2 16 77 5.0E-06
sp|Q03257|SRY_SHEEP Sex-determining region Y protein OS=Ovis aries GN=SRY PE=3 SV=2 16 84 5.0E-06
sp|Q03255|SRY_BOVIN Sex-determining region Y protein OS=Bos taurus GN=SRY PE=3 SV=2 16 77 5.0E-06
sp|Q7JGF9|SRY_BOSGF Sex-determining region Y protein OS=Bos gaurus frontalis GN=SRY PE=3 SV=1 16 77 5.0E-06
sp|Q7JGF7|SRY_BOSIN Sex-determining region Y protein OS=Bos indicus GN=SRY PE=3 SV=1 16 77 5.0E-06
sp|P47792|SX19A_DANRE Transcription factor Sox-19a OS=Danio rerio GN=sox19a PE=1 SV=2 16 76 6.0E-06
sp|P40646|SOX7_MOUSE Transcription factor SOX-7 OS=Mus musculus GN=Sox7 PE=1 SV=2 16 97 6.0E-06
sp|P40650|SX11B_XENLA Transcription factor Sox-11-B OS=Xenopus laevis GN=sox11-b PE=1 SV=2 16 86 7.0E-06
sp|P36631|STE11_SCHPO Transcription factor ste11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ste11 PE=1 SV=2 19 72 7.0E-06
sp|Q24533|DICH_DROME SOX domain-containing protein dichaete OS=Drosophila melanogaster GN=D PE=2 SV=1 16 72 7.0E-06
sp|Q9BT81|SOX7_HUMAN Transcription factor SOX-7 OS=Homo sapiens GN=SOX7 PE=1 SV=1 16 72 8.0E-06
sp|Q7SZS1|SX21A_DANRE Transcription factor Sox-21-A OS=Danio rerio GN=sox21a PE=2 SV=1 16 72 8.0E-06
sp|Q67EX7|SRY_MOSBE Sex-determining region Y protein OS=Moschus berezovskii GN=SRY PE=3 SV=1 16 84 8.0E-06
sp|Q864Q7|SRY_EUBAS Sex-determining region Y protein OS=Eubalaena australis GN=SRY PE=3 SV=1 16 120 9.0E-06
sp|Q863B7|SRY_ELADA Sex-determining region Y protein OS=Elaphurus davidianus GN=SRY PE=3 SV=1 16 77 9.0E-06
sp|Q863C2|SRY_AXIPR Sex-determining region Y protein OS=Axis porcinus GN=SRY PE=3 SV=1 16 77 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
HMG

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5347
MVEDMVLLLLLLVVAQVTADNPKLSNPDISKIIGEKWKNEGDEVKQNWKKLAEEEKQRHQNQYPNYRYQPRRGNK
PQPGWASTSPTEEHGRCPKCHGRAMATPQTPSTPFATSPAGKMAAAAAAASQGPPSLQRLDTALSRRSSFEQSPT
SGLPFPSAKLPPVRDVEKSEPMSPEMKRRRADGAGAYHVINGPPLGSYAAAKPPGADLCLTPTDGLAANPLHAVA
RCLRP*
Coding >Hirsu2|5347
ATGGTGGAGGACATGGTGCTGCTGCTGCTGCTGCTGGTGGTGGCCCAGGTCACGGCCGACAACCCCAAGCTGTCC
AACCCGGACATCTCCAAGATCATCGGCGAGAAGTGGAAGAACGAGGGCGACGAGGTCAAGCAGAACTGGAAGAAG
CTGGCCGAGGAGGAGAAGCAGCGGCACCAGAACCAATACCCAAACTACCGCTACCAGCCGCGCCGCGGCAACAAG
CCCCAGCCCGGCTGGGCCAGCACCTCGCCGACCGAGGAGCACGGCCGCTGCCCCAAGTGCCACGGCCGGGCCATG
GCCACGCCCCAGACGCCCTCGACGCCCTTCGCCACCTCGCCCGCCGGCAAGATGGCCGCCGCCGCCGCCGCCGCC
TCGCAGGGCCCGCCCAGCCTGCAGCGGCTCGACACGGCCCTCTCGCGCCGCTCCAGCTTCGAGCAGTCGCCCACC
AGCGGCCTGCCCTTCCCCTCGGCCAAGCTGCCGCCCGTCCGCGACGTCGAGAAGAGCGAGCCCATGTCGCCCGAG
ATGAAGCGGCGCCGGGCCGACGGCGCCGGCGCCTACCACGTCATCAACGGGCCGCCGCTCGGCAGCTACGCCGCC
GCCAAGCCGCCCGGCGCCGACCTCTGCCTGACGCCGACCGACGGCCTCGCCGCGAACCCCCTGCACGCAGTGGCC
CGATGCCTCCGCCCCTGA
Transcript >Hirsu2|5347
ATGGTGGAGGACATGGTGCTGCTGCTGCTGCTGCTGGTGGTGGCCCAGGTCACGGCCGACAACCCCAAGCTGTCC
AACCCGGACATCTCCAAGATCATCGGCGAGAAGTGGAAGAACGAGGGCGACGAGGTCAAGCAGAACTGGAAGAAG
CTGGCCGAGGAGGAGAAGCAGCGGCACCAGAACCAATACCCAAACTACCGCTACCAGCCGCGCCGCGGCAACAAG
CCCCAGCCCGGCTGGGCCAGCACCTCGCCGACCGAGGAGCACGGCCGCTGCCCCAAGTGCCACGGCCGGGCCATG
GCCACGCCCCAGACGCCCTCGACGCCCTTCGCCACCTCGCCCGCCGGCAAGATGGCCGCCGCCGCCGCCGCCGCC
TCGCAGGGCCCGCCCAGCCTGCAGCGGCTCGACACGGCCCTCTCGCGCCGCTCCAGCTTCGAGCAGTCGCCCACC
AGCGGCCTGCCCTTCCCCTCGGCCAAGCTGCCGCCCGTCCGCGACGTCGAGAAGAGCGAGCCCATGTCGCCCGAG
ATGAAGCGGCGCCGGGCCGACGGCGCCGGCGCCTACCACGTCATCAACGGGCCGCCGCTCGGCAGCTACGCCGCC
GCCAAGCCGCCCGGCGCCGACCTCTGCCTGACGCCGACCGACGGCCTCGCCGCGAACCCCCTGCACGCAGTGGCC
CGATGCCTCCGCCCCTGA
Gene >Hirsu2|5347
ATGGTGGAGGACATGGTGCTGCTGCTGCTGCTGCTGGTGGTGGTGCACAGACAAACGGACGGACGAAAGACGACG
AGACGGACTGACACCCGAGGCTGACCTGCTTGCTTTCTTCCCTCGCGTCGCACAGCCTTCATCCTCTACCGACAA
CACCACCAGGCCCAGGTCACGGCCGACAACCCCAAGCTGTCCAACCCGGACATCTCCAAGATCATCGGCGAGAAG
TGGAAGAACGAGGGCGACGAGGTCAAGCAGAACTGGAAGAAGCTGGCCGAGGAGGAGAAGCAGCGGCACCAGAAC
CAATACCCAAACTACCGCTACCAGCCGCGCCGCGGCAACAAGCCCCAGCCCGGCTGGGCCAGCACCTCGCCGACC
GAGGAGCACGGCCGCTGCCCCAAGTGCCACGGCCGGGCCATGGCCACGCCCCAGACGCCCTCGACGCCCTTCGCC
ACCTCGCCCGCCGGCAAGATGGCCGCCGCCGCCGCCGCCGCCTCGCAGGGCCCGCCCAGCCTGCAGCGGCTCGAC
ACGGCCCTCTCGCGCCGCTCCAGCTTCGAGCAGTCGCCCACCAGCGGCCTGCCCTTCCCCTCGGCCAAGCTGCCG
CCCGTCCGCGACGTCGAGAAGAGCGAGCCCATGTCGCCCGAGATGAAGCGGCGCCGGGCCGACGGCGCCGGCGCC
TACCACGTCATCAACGGGCCGCCGCTCGGCAGCTACGCCGCCGCCAAGCCGCCCGGCGCCGACCTCTGCCTGACG
CCGACCGACGGCCTCGCCGCGAACCCCCTGCACGCGTACGCGCGAACGCCCCTGCCCGAGCTGGGCAGCCTAAGC
CGATCGCAGAGTGGCCCGATGCCTCCGCCCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail