Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5342
Gene name
LocationContig_267:18399..20115
Strand-
Gene length (bp)1716
Transcript length (bp)1626
Coding sequence length (bp)1626
Protein length (aa) 542

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07994 NAD_binding_5 Myo-inositol-1-phosphate synthase 1.6E-145 85 523
PF01658 Inos-1-P_synth Myo-inositol-1-phosphate synthase 1.1E-44 337 450

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P42801|INO1_ARATH Inositol-3-phosphate synthase isozyme 1 OS=Arabidopsis thaliana GN=IPS1 PE=1 SV=3 31 539 0.0E+00
sp|Q6FQI1|INO1_CANGA Inositol-3-phosphate synthase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=INO1 PE=3 SV=1 39 540 0.0E+00
sp|P11986|INO1_YEAST Inositol-3-phosphate synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INO1 PE=1 SV=3 31 541 0.0E+00
sp|P42800|INO1_CANAL Inositol-3-phosphate synthase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=INO1 PE=3 SV=1 27 540 0.0E+00
sp|O97477|INO1_DROME Inositol-3-phosphate synthase OS=Drosophila melanogaster GN=Inos PE=1 SV=1 34 540 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P42801|INO1_ARATH Inositol-3-phosphate synthase isozyme 1 OS=Arabidopsis thaliana GN=IPS1 PE=1 SV=3 31 539 0.0E+00
sp|Q6FQI1|INO1_CANGA Inositol-3-phosphate synthase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=INO1 PE=3 SV=1 39 540 0.0E+00
sp|P11986|INO1_YEAST Inositol-3-phosphate synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INO1 PE=1 SV=3 31 541 0.0E+00
sp|P42800|INO1_CANAL Inositol-3-phosphate synthase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=INO1 PE=3 SV=1 27 540 0.0E+00
sp|O97477|INO1_DROME Inositol-3-phosphate synthase OS=Drosophila melanogaster GN=Inos PE=1 SV=1 34 540 0.0E+00
sp|P42802|INO1_CITPA Inositol-3-phosphate synthase OS=Citrus paradisi PE=3 SV=1 31 539 0.0E+00
sp|Q4R6E3|INO1_MACFA Inositol-3-phosphate synthase 1 OS=Macaca fascicularis GN=ISYNA1 PE=2 SV=1 32 540 0.0E+00
sp|Q6AYK3|INO1_RAT Inositol-3-phosphate synthase 1 OS=Rattus norvegicus GN=Isyna1 PE=3 SV=2 32 540 0.0E+00
sp|Q9NPH2|INO1_HUMAN Inositol-3-phosphate synthase 1 OS=Homo sapiens GN=ISYNA1 PE=1 SV=1 32 540 0.0E+00
sp|Q9JHU9|INO1_MOUSE Inositol-3-phosphate synthase 1 OS=Mus musculus GN=Isyna1 PE=1 SV=1 32 540 0.0E+00
sp|Q2NL29|INO1_BOVIN Inositol-3-phosphate synthase 1 OS=Bos taurus GN=ISYNA1 PE=2 SV=1 32 540 0.0E+00
sp|Q7ZXY0|INO1A_XENLA Inositol-3-phosphate synthase 1-A OS=Xenopus laevis GN=isyna1-a PE=2 SV=1 32 540 0.0E+00
sp|Q41107|INO1_PHAVU Inositol-3-phosphate synthase OS=Phaseolus vulgaris PE=2 SV=1 31 539 0.0E+00
sp|Q6DDT1|INO1B_XENLA Inositol-3-phosphate synthase 1-B OS=Xenopus laevis GN=isyna1-b PE=2 SV=2 32 540 0.0E+00
sp|Q9FYV1|INO1_SESIN Inositol-3-phosphate synthase OS=Sesamum indicum PE=2 SV=1 31 539 0.0E+00
sp|O65195|INO1_HORVU Inositol-3-phosphate synthase OS=Hordeum vulgare PE=2 SV=1 31 539 0.0E+00
sp|Q96348|INO1_BRANA Inositol-3-phosphate synthase OS=Brassica napus PE=2 SV=2 31 539 0.0E+00
sp|Q40271|INO1_MESCR Inositol-3-phosphate synthase OS=Mesembryanthemum crystallinum PE=2 SV=1 31 539 0.0E+00
sp|Q9LX12|INO3_ARATH Probable inositol 3-phosphate synthase isozyme 3 OS=Arabidopsis thaliana GN=IPS3 PE=1 SV=1 31 539 0.0E+00
sp|P42803|INO1_SPIPO Inositol-3-phosphate synthase OS=Spirodela polyrhiza GN=TUR1 PE=2 SV=1 32 539 0.0E+00
sp|O64437|INO1_ORYSJ Inositol-3-phosphate synthase OS=Oryza sativa subsp. japonica GN=INO1 PE=2 SV=2 31 539 0.0E+00
sp|Q9FPK7|INO1_MAIZE Inositol-3-phosphate synthase OS=Zea mays PE=2 SV=2 31 539 0.0E+00
sp|Q9S7U0|INO1_WHEAT Inositol-3-phosphate synthase OS=Triticum aestivum GN=MIPS PE=2 SV=1 31 539 0.0E+00
sp|Q38862|INO2_ARATH Inositol-3-phosphate synthase isozyme 2 OS=Arabidopsis thaliana GN=IPS2 PE=1 SV=2 31 539 0.0E+00
sp|Q54N49|INO1_DICDI Inositol-3-phosphate synthase OS=Dictyostelium discoideum GN=ino1 PE=3 SV=1 31 540 0.0E+00
sp|Q9SSV4|INO1_NICPA Inositol-3-phosphate synthase OS=Nicotiana paniculata GN=INPS1 PE=2 SV=1 31 539 0.0E+00
sp|Q9LW96|INO1_TOBAC Inositol-3-phosphate synthase OS=Nicotiana tabacum PE=2 SV=1 31 539 0.0E+00
[Show less]

GO

GO Term Description Terminal node
GO:0004512 inositol-3-phosphate synthase activity Yes
GO:0008654 phospholipid biosynthetic process Yes
GO:0006021 inositol biosynthetic process Yes
GO:0008152 metabolic process No
GO:0044283 small molecule biosynthetic process No
GO:0090407 organophosphate biosynthetic process No
GO:0006793 phosphorus metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006629 lipid metabolic process No
GO:0005975 carbohydrate metabolic process No
GO:0046173 polyol biosynthetic process No
GO:0044238 primary metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0008150 biological_process No
GO:0008610 lipid biosynthetic process No
GO:0044255 cellular lipid metabolic process No
GO:0003674 molecular_function No
GO:1901615 organic hydroxy compound metabolic process No
GO:0044262 cellular carbohydrate metabolic process No
GO:0006066 alcohol metabolic process No
GO:0009058 biosynthetic process No
GO:0006644 phospholipid metabolic process No
GO:0009987 cellular process No
GO:0016051 carbohydrate biosynthetic process No
GO:0044281 small molecule metabolic process No
GO:1901617 organic hydroxy compound biosynthetic process No
GO:0016872 intramolecular lyase activity No
GO:0003824 catalytic activity No
GO:0044249 cellular biosynthetic process No
GO:0044237 cellular metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0046165 alcohol biosynthetic process No
GO:0019751 polyol metabolic process No
GO:0034637 cellular carbohydrate biosynthetic process No
GO:0019637 organophosphate metabolic process No
GO:0016853 isomerase activity No
GO:0006020 inositol metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5342
MAPHAQVTTGSSNGVSHANRAAAAAAASPGSFVVNSPNVTYTDAEIKSKYTYRTTSVEADANGNLVATPKEVLYD
FKVDRRVPRVGMMLVGWGGNNGTTVTAGILANRRGLVWETKEGPREANYYGSVVMGSTVKLGTEARTNKEVNVPF
HSVLPMVHPNDLVIGGWDISSMNLAQAMDRAQVLEPMLKAQVKKEMAAMVPLPSIYYPDFIAANQEDRADNVLEG
TRASTAHVEQLRKDIRDFKANNGLDKVIVMWTANTERYADIIPGVNDTADNLLGAIEQGHDEVSPSTVFAVACIL
ENAPFINGSPQNTFVPGAIQLAERHNAYIGGDDFKSGQTKMKSALVDFLINAGIKLTSIASYNHLGNNDGKNLSS
QKQFRSKEISKSNVVDDMVEANSVLYKEGEHPDHCVVIKYMPAVADNKRALDEYYAEIFLGGHQTISLFNICEDS
LLASPLIIDLVIVAEMMTRIQWRASGADGGSYRNFHSVLSVLSYMLKAPMTPPGTPVVNALAKQRAALTNIFRAC
VGLEPESDMTLEHKLL*
Coding >Hirsu2|5342
ATGGCTCCCCACGCGCAGGTCACGACGGGCTCCTCGAACGGTGTGAGCCATGCCAACCGTGCTGCTGCCGCCGCC
GCCGCCTCCCCGGGCTCCTTCGTCGTCAACTCGCCCAACGTCACCTACACCGATGCCGAGATCAAGTCCAAGTAC
ACCTACCGCACCACCAGTGTCGAGGCAGATGCCAATGGCAACCTCGTCGCCACCCCCAAGGAGGTGCTCTACGAC
TTCAAGGTCGACCGCCGCGTCCCCCGCGTCGGCATGATGCTCGTCGGCTGGGGCGGAAACAACGGCACCACCGTC
ACCGCCGGCATTCTCGCCAACCGCCGCGGCCTCGTCTGGGAGACCAAGGAAGGGCCCCGTGAGGCCAACTACTAC
GGCTCCGTCGTCATGGGCTCCACCGTCAAGCTGGGCACCGAAGCCAGGACGAACAAGGAGGTCAACGTGCCCTTC
CATAGCGTCCTGCCCATGGTCCACCCCAATGACCTCGTCATCGGCGGCTGGGACATTAGCAGCATGAACCTGGCC
CAGGCCATGGACCGCGCCCAGGTCCTCGAGCCCATGCTCAAGGCTCAGGTCAAAAAGGAGATGGCCGCCATGGTC
CCTCTCCCCTCCATCTACTATCCCGACTTTATTGCCGCCAACCAGGAGGACCGCGCCGACAACGTCCTCGAGGGC
ACCAGGGCCTCCACGGCCCACGTCGAGCAGCTGCGCAAGGACATTCGCGACTTCAAGGCCAACAACGGCCTCGAC
AAGGTCATTGTCATGTGGACGGCCAATACGGAGCGATACGCCGACATCATCCCGGGCGTCAACGACACCGCCGAC
AATCTCCTCGGCGCCATTGAGCAGGGCCACGACGAGGTCTCGCCTTCGACCGTCTTCGCTGTCGCCTGTATCCTC
GAGAACGCGCCCTTCATCAACGGCTCGCCCCAGAACACCTTTGTGCCCGGCGCCATCCAGTTGGCCGAGAGGCAC
AACGCTTACATCGGTGGCGACGACTTCAAGTCTGGCCAGACCAAGATGAAGTCGGCCCTCGTCGACTTCCTCATC
AACGCCGGCATCAAACTCACCTCTATTGCTAGCTACAACCACCTGGGCAACAACGACGGCAAGAACCTGAGCTCC
CAGAAGCAGTTCCGCTCTAAGGAGATCTCCAAGTCCAACGTCGTCGACGACATGGTCGAGGCCAACTCCGTCCTG
TACAAGGAGGGCGAGCATCCCGACCACTGTGTCGTCATCAAGTACATGCCGGCCGTCGCCGACAACAAGCGTGCT
CTGGATGAGTACTACGCCGAGATCTTCCTTGGAGGCCACCAGACCATCTCTCTATTCAACATCTGCGAGGACTCC
CTACTGGCATCGCCCCTCATCATTGACCTTGTCATTGTCGCCGAGATGATGACTCGCATCCAGTGGCGTGCCTCG
GGCGCCGACGGCGGCAGCTACAGGAACTTCCACAGCGTCCTGAGCGTCCTCAGCTACATGCTCAAGGCCCCGATG
ACGCCTCCGGGCACGCCCGTCGTCAACGCCCTCGCCAAGCAGCGCGCCGCACTGACCAACATCTTCCGCGCCTGT
GTGGGCCTCGAGCCCGAGTCGGACATGACGCTGGAGCACAAGCTGCTGTAG
Transcript >Hirsu2|5342
ATGGCTCCCCACGCGCAGGTCACGACGGGCTCCTCGAACGGTGTGAGCCATGCCAACCGTGCTGCTGCCGCCGCC
GCCGCCTCCCCGGGCTCCTTCGTCGTCAACTCGCCCAACGTCACCTACACCGATGCCGAGATCAAGTCCAAGTAC
ACCTACCGCACCACCAGTGTCGAGGCAGATGCCAATGGCAACCTCGTCGCCACCCCCAAGGAGGTGCTCTACGAC
TTCAAGGTCGACCGCCGCGTCCCCCGCGTCGGCATGATGCTCGTCGGCTGGGGCGGAAACAACGGCACCACCGTC
ACCGCCGGCATTCTCGCCAACCGCCGCGGCCTCGTCTGGGAGACCAAGGAAGGGCCCCGTGAGGCCAACTACTAC
GGCTCCGTCGTCATGGGCTCCACCGTCAAGCTGGGCACCGAAGCCAGGACGAACAAGGAGGTCAACGTGCCCTTC
CATAGCGTCCTGCCCATGGTCCACCCCAATGACCTCGTCATCGGCGGCTGGGACATTAGCAGCATGAACCTGGCC
CAGGCCATGGACCGCGCCCAGGTCCTCGAGCCCATGCTCAAGGCTCAGGTCAAAAAGGAGATGGCCGCCATGGTC
CCTCTCCCCTCCATCTACTATCCCGACTTTATTGCCGCCAACCAGGAGGACCGCGCCGACAACGTCCTCGAGGGC
ACCAGGGCCTCCACGGCCCACGTCGAGCAGCTGCGCAAGGACATTCGCGACTTCAAGGCCAACAACGGCCTCGAC
AAGGTCATTGTCATGTGGACGGCCAATACGGAGCGATACGCCGACATCATCCCGGGCGTCAACGACACCGCCGAC
AATCTCCTCGGCGCCATTGAGCAGGGCCACGACGAGGTCTCGCCTTCGACCGTCTTCGCTGTCGCCTGTATCCTC
GAGAACGCGCCCTTCATCAACGGCTCGCCCCAGAACACCTTTGTGCCCGGCGCCATCCAGTTGGCCGAGAGGCAC
AACGCTTACATCGGTGGCGACGACTTCAAGTCTGGCCAGACCAAGATGAAGTCGGCCCTCGTCGACTTCCTCATC
AACGCCGGCATCAAACTCACCTCTATTGCTAGCTACAACCACCTGGGCAACAACGACGGCAAGAACCTGAGCTCC
CAGAAGCAGTTCCGCTCTAAGGAGATCTCCAAGTCCAACGTCGTCGACGACATGGTCGAGGCCAACTCCGTCCTG
TACAAGGAGGGCGAGCATCCCGACCACTGTGTCGTCATCAAGTACATGCCGGCCGTCGCCGACAACAAGCGTGCT
CTGGATGAGTACTACGCCGAGATCTTCCTTGGAGGCCACCAGACCATCTCTCTATTCAACATCTGCGAGGACTCC
CTACTGGCATCGCCCCTCATCATTGACCTTGTCATTGTCGCCGAGATGATGACTCGCATCCAGTGGCGTGCCTCG
GGCGCCGACGGCGGCAGCTACAGGAACTTCCACAGCGTCCTGAGCGTCCTCAGCTACATGCTCAAGGCCCCGATG
ACGCCTCCGGGCACGCCCGTCGTCAACGCCCTCGCCAAGCAGCGCGCCGCACTGACCAACATCTTCCGCGCCTGT
GTGGGCCTCGAGCCCGAGTCGGACATGACGCTGGAGCACAAGCTGCTGTAG
Gene >Hirsu2|5342
ATGGCTCCCCACGCGCAGGTCACGACGGGCTCCTCGAACGGTGTGAGCCATGCCAACCGTGCTGCTGCCGCCGCC
GCCGCCTCCCCGGGCTCCTTCGTCGTCAACTCGCCCAACGTCACCTACACCGATGCCGAGATCAAGTCCAAGTAC
ACCTACCGCACCACCAGTGTCGAGGCAGATGCCAATGGCAACCTCGTCGCCACCCCCAAGGAGGTGCTCTACGAC
TTCAAGGTCGACCGCCGCGTCCCCCGCGTCGGCATGATGCTCGTCGGCTGGGGCGGAAACAACGGCACCACCGTC
ACCGCCGGCATTCTCGCCAACCGCCGCGGCCTCGTCTGGGAGACCAAGGAAGGGCCCCGTGAGGCCAACTACTAC
GGCTCCGTCGTCATGGGCTCCACCGTCAAGCTGGGCACCGAAGCCAGGACGAACAAGGAGGTCAACGTGCCCTTC
CATAGCGTCCTGCCCATGGTCCACCCCAATGACCTCGTCATCGGCGGCTGGGACATTAGCAGCATGAACCTGGCC
CAGGCCATGGACCGCGCCCAGGTCCTCGAGCCCATGCTCAAGGCTCAGGTCAAAAAGGAGATGGCCGCCATGGTC
CCTCTCCCCTCCATCTACTATCCCGACTTTATTGCCGCCAACCAGGAGGACCGCGCCGACAACGTCCTCGAGGGC
ACCAGGGCCTCCACGGCCCACGTCGAGCAGCTGCGCAAGGACATTCGCGACTTCAAGGCCAACAACGGCCTCGAC
AAGGTCATTGTCATGTGGACGGCCAATACGGAGCGATACGCCGACATCATCCCGGGCGTCAACGACACCGCCGAC
AATCTCCTCGGCGCCATTGAGCAGGGCCACGACGAGGTCTCGCCTTCGACCGTCTTCGCTGTCGCCTGTATCCTC
GAGAACGCGCCCTTCATCAACGGCTCGCCCCAGAACACCTTTGTGCCCGGCGCCATCCAGTTGGCCGAGAGGCAC
AACGCTTACATCGGTGGCGACGACTTCAAGTCTGGCCAGACCAAGATGAAGTCGGCCCTCGTCGACTTCCTCATC
AACGCCGGCATCAAACTCACCTCTATTGCTAGCTACAACCACCTGGGCAACAACGACGGCAAGAACCTGAGCTCC
CAGAAGCAGTTCCGCTCTAAGGAGATCTCCAAGTCCAACGTCGTCGACGACATGGTCGAGGCCAACTCCGTCCTG
TACAAGGAGGGCGAGCATCCCGACCACTGTGTCGTCATCAAGTACATGCCGGCCGTCGCCGACAACAAGCGTGCT
CTGGATGAGTACTACGCCGAGATCTTCCTTGGAGGCCACCAGACCATCTCGTGAGTGCTTCCCCGTCCTCCCCTC
TTTTTTCTGCGCACCAGCCATGTGCGCCGATAGCGGTAGAGTGTGCTGACGGAGGAATGCACAAGTCTATTCAAC
ATCTGCGAGGACTCCCTACTGGCATCGCCCCTCATCATTGACCTTGTCATTGTCGCCGAGATGATGACTCGCATC
CAGTGGCGTGCCTCGGGCGCCGACGGCGGCAGCTACAGGAACTTCCACAGCGTCCTGAGCGTCCTCAGCTACATG
CTCAAGGCCCCGATGACGCCTCCGGGCACGCCCGTCGTCAACGCCCTCGCCAAGCAGCGCGCCGCACTGACCAAC
ATCTTCCGCGCCTGTGTGGGCCTCGAGCCCGAGTCGGACATGACGCTGGAGCACAAGCTGCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail