Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5339
Gene name
LocationContig_267:3775..5467
Strand+
Gene length (bp)1692
Transcript length (bp)1389
Coding sequence length (bp)1389
Protein length (aa) 463

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01148 CTP_transf_1 Cytidylyltransferase family 1.1E-77 77 407

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P381|CDSH_SCHPO Putative phosphatidate cytidylyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC13A2.03 PE=1 SV=1 34 453 3.0E-156
sp|P38221|CDS1_YEAST Phosphatidate cytidylyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDS1 PE=1 SV=1 11 451 8.0E-137
sp|O49639|CDS2_ARATH Phosphatidate cytidylyltransferase 2 OS=Arabidopsis thaliana GN=CDS2 PE=1 SV=1 38 454 7.0E-107
sp|O04928|CDS1_ARATH Phosphatidate cytidylyltransferase 1 OS=Arabidopsis thaliana GN=CDS1 PE=1 SV=1 69 445 6.0E-105
sp|Q92903|CDS1_HUMAN Phosphatidate cytidylyltransferase 1 OS=Homo sapiens GN=CDS1 PE=2 SV=2 5 449 4.0E-100
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P381|CDSH_SCHPO Putative phosphatidate cytidylyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC13A2.03 PE=1 SV=1 34 453 3.0E-156
sp|P38221|CDS1_YEAST Phosphatidate cytidylyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDS1 PE=1 SV=1 11 451 8.0E-137
sp|O49639|CDS2_ARATH Phosphatidate cytidylyltransferase 2 OS=Arabidopsis thaliana GN=CDS2 PE=1 SV=1 38 454 7.0E-107
sp|O04928|CDS1_ARATH Phosphatidate cytidylyltransferase 1 OS=Arabidopsis thaliana GN=CDS1 PE=1 SV=1 69 445 6.0E-105
sp|Q92903|CDS1_HUMAN Phosphatidate cytidylyltransferase 1 OS=Homo sapiens GN=CDS1 PE=2 SV=2 5 449 4.0E-100
sp|A0JNC1|CDS2_BOVIN Phosphatidate cytidylyltransferase 2 OS=Bos taurus GN=CDS2 PE=2 SV=1 27 449 1.0E-99
sp|Q99L43|CDS2_MOUSE Phosphatidate cytidylyltransferase 2 OS=Mus musculus GN=Cds2 PE=1 SV=1 34 449 5.0E-99
sp|O04940|CDS1_SOLTU Phosphatidate cytidylyltransferase 1 OS=Solanum tuberosum GN=CDS1 PE=1 SV=1 20 454 7.0E-99
sp|O35052|CDS1_RAT Phosphatidate cytidylyltransferase 1 OS=Rattus norvegicus GN=Cds1 PE=1 SV=2 20 449 1.0E-98
sp|O95674|CDS2_HUMAN Phosphatidate cytidylyltransferase 2 OS=Homo sapiens GN=CDS2 PE=1 SV=1 34 449 2.0E-98
sp|P98191|CDS1_MOUSE Phosphatidate cytidylyltransferase 1 OS=Mus musculus GN=Cds1 PE=1 SV=2 20 449 2.0E-98
sp|Q91XU8|CDS2_RAT Phosphatidate cytidylyltransferase 2 OS=Rattus norvegicus GN=Cds2 PE=1 SV=1 34 448 3.0E-96
sp|P56079|CDSA_DROME Phosphatidate cytidylyltransferase, photoreceptor-specific OS=Drosophila melanogaster GN=CdsA PE=1 SV=2 3 444 2.0E-91
sp|Q1PE48|CDS3_ARATH Phosphatidate cytidylyltransferase 3 OS=Arabidopsis thaliana GN=CDS3 PE=1 SV=1 45 445 3.0E-90
sp|P53439|CDSA_CAEEL Phosphatidate cytidylyltransferase OS=Caenorhabditis elegans GN=cdgs-1 PE=3 SV=2 3 448 8.0E-89
sp|Q55D90|CDSA_DICDI Probable phosphatidate cytidylyltransferase OS=Dictyostelium discoideum GN=cdsA PE=3 SV=1 85 440 7.0E-77
sp|Q95ZE3|CDS1_ENCCU Phosphatidate cytidylyltransferase OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDS1 PE=3 SV=1 174 440 3.0E-45
sp|P75160|CDSA_MYCPN Putative phosphatidate cytidylyltransferase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=cdsA PE=3 SV=1 223 391 7.0E-09
sp|O67292|CDSA_AQUAE Phosphatidate cytidylyltransferase OS=Aquifex aeolicus (strain VF5) GN=cdsA PE=3 SV=1 241 391 1.0E-08
sp|O25004|CDSA_HELPY Phosphatidate cytidylyltransferase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=cdsA PE=3 SV=1 228 414 4.0E-06
sp|Q49433|CDSA_MYCGE Putative phosphatidate cytidylyltransferase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=cdsA PE=3 SV=1 184 389 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

Domain # Start End Length
1 79 96 17
2 100 122 22
3 135 154 19
4 169 191 22
5 203 221 18
6 231 253 22
7 266 288 22
8 344 366 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5339
MGRTRRGVRFPHGAAGASVNGHASGSEGHRSSFSGSEDGSGSPSRTRIKSQAQLAPVQEKQPTAEEEYQKKKANF
MTRTFWTFSMLAMFFTALFMGHIYIIAIVTAVQIVSFKEVIAIANVPSRARSIRSTKSLNWYWLASTMYFLYGES
VIYYFKHVVLVDKVLLPLATHHRFISFILYVFGFVCFVATLKAGHYKFQFTNFAWTHMALYLIVVQAHFVMNNVF
EGMIWFFLPAALVITNDIFAYICGIAFGRTQLIKLSPKKTVEGFVGAWIMTILFGMLLVNLMIRSKYFICPVNDL
GANIFTGLECDPNPVFVPRTYHLPQLFFLPQNTTFSLTFAPMQLHTLVLASFASLIAPFGGFFASGLKRTFKIKD
FGDSIPGHGGMTDRMDCQFIMGLFAFMYYHTFIEVHKVTLGSVLETAITSLNPEEQVELVKGMARYLGNQGVVSE
QVLGCIDQVMKR*
Coding >Hirsu2|5339
ATGGGCCGGACGAGGAGAGGCGTCAGATTCCCGCACGGCGCTGCCGGCGCGTCCGTCAACGGCCATGCCAGCGGC
TCCGAAGGCCATCGCTCCAGCTTCAGCGGCTCCGAGGACGGCTCCGGGTCGCCTTCGAGGACCCGGATCAAGTCG
CAGGCACAGCTGGCTCCCGTGCAGGAGAAGCAGCCGACGGCCGAGGAAGAGTACCAGAAGAAAAAGGCAAACTTC
ATGACGCGCACCTTCTGGACCTTCAGCATGCTCGCCATGTTCTTCACTGCCCTCTTCATGGGCCACATATACATC
ATAGCCATCGTGACCGCCGTCCAGATTGTCTCCTTCAAGGAGGTCATCGCCATCGCCAACGTCCCCAGCCGCGCT
CGATCCATCCGCTCCACCAAGAGCCTCAACTGGTACTGGCTCGCCTCCACCATGTACTTTCTCTACGGCGAGAGC
GTCATCTACTACTTCAAGCATGTCGTCCTCGTCGACAAGGTCTTGCTGCCCCTAGCCACTCACCACCGCTTCATC
AGCTTCATCCTCTACGTCTTCGGCTTCGTCTGCTTCGTCGCTACTCTCAAGGCCGGCCATTACAAATTCCAGTTC
ACCAACTTCGCCTGGACACACATGGCGCTCTACCTCATCGTCGTGCAAGCCCACTTTGTCATGAACAATGTTTTC
GAGGGCATGATCTGGTTTTTCCTGCCCGCCGCTCTCGTCATCACAAACGACATATTTGCCTACATCTGTGGCATC
GCTTTCGGTCGCACCCAGCTCATCAAGCTGTCCCCTAAGAAGACGGTTGAGGGTTTTGTGGGAGCCTGGATCATG
ACTATTCTCTTCGGCATGCTACTCGTCAACCTCATGATTCGCTCCAAATATTTCATTTGCCCCGTCAATGATCTC
GGCGCCAACATCTTCACCGGCCTTGAGTGCGATCCGAACCCCGTCTTCGTCCCTCGTACCTACCATCTGCCGCAG
CTATTCTTCTTGCCGCAAAACACGACTTTCTCGCTCACCTTCGCCCCCATGCAACTGCACACGTTGGTCCTCGCC
TCGTTTGCCTCTCTAATCGCGCCTTTCGGTGGCTTCTTCGCTTCCGGCCTGAAGCGGACCTTCAAGATCAAGGAT
TTTGGCGATTCCATTCCCGGCCACGGCGGCATGACGGATCGTATGGACTGCCAGTTCATCATGGGCTTATTCGCC
TTCATGTACTACCACACCTTCATCGAGGTCCACAAGGTCACCTTGGGCTCTGTGCTTGAAACGGCCATCACCAGC
TTGAATCCAGAGGAGCAGGTCGAGCTTGTGAAGGGCATGGCTCGCTACCTCGGTAACCAGGGAGTTGTGTCAGAA
CAGGTTCTGGGCTGTATTGACCAAGTCATGAAGCGATGA
Transcript >Hirsu2|5339
ATGGGCCGGACGAGGAGAGGCGTCAGATTCCCGCACGGCGCTGCCGGCGCGTCCGTCAACGGCCATGCCAGCGGC
TCCGAAGGCCATCGCTCCAGCTTCAGCGGCTCCGAGGACGGCTCCGGGTCGCCTTCGAGGACCCGGATCAAGTCG
CAGGCACAGCTGGCTCCCGTGCAGGAGAAGCAGCCGACGGCCGAGGAAGAGTACCAGAAGAAAAAGGCAAACTTC
ATGACGCGCACCTTCTGGACCTTCAGCATGCTCGCCATGTTCTTCACTGCCCTCTTCATGGGCCACATATACATC
ATAGCCATCGTGACCGCCGTCCAGATTGTCTCCTTCAAGGAGGTCATCGCCATCGCCAACGTCCCCAGCCGCGCT
CGATCCATCCGCTCCACCAAGAGCCTCAACTGGTACTGGCTCGCCTCCACCATGTACTTTCTCTACGGCGAGAGC
GTCATCTACTACTTCAAGCATGTCGTCCTCGTCGACAAGGTCTTGCTGCCCCTAGCCACTCACCACCGCTTCATC
AGCTTCATCCTCTACGTCTTCGGCTTCGTCTGCTTCGTCGCTACTCTCAAGGCCGGCCATTACAAATTCCAGTTC
ACCAACTTCGCCTGGACACACATGGCGCTCTACCTCATCGTCGTGCAAGCCCACTTTGTCATGAACAATGTTTTC
GAGGGCATGATCTGGTTTTTCCTGCCCGCCGCTCTCGTCATCACAAACGACATATTTGCCTACATCTGTGGCATC
GCTTTCGGTCGCACCCAGCTCATCAAGCTGTCCCCTAAGAAGACGGTTGAGGGTTTTGTGGGAGCCTGGATCATG
ACTATTCTCTTCGGCATGCTACTCGTCAACCTCATGATTCGCTCCAAATATTTCATTTGCCCCGTCAATGATCTC
GGCGCCAACATCTTCACCGGCCTTGAGTGCGATCCGAACCCCGTCTTCGTCCCTCGTACCTACCATCTGCCGCAG
CTATTCTTCTTGCCGCAAAACACGACTTTCTCGCTCACCTTCGCCCCCATGCAACTGCACACGTTGGTCCTCGCC
TCGTTTGCCTCTCTAATCGCGCCTTTCGGTGGCTTCTTCGCTTCCGGCCTGAAGCGGACCTTCAAGATCAAGGAT
TTTGGCGATTCCATTCCCGGCCACGGCGGCATGACGGATCGTATGGACTGCCAGTTCATCATGGGCTTATTCGCC
TTCATGTACTACCACACCTTCATCGAGGTCCACAAGGTCACCTTGGGCTCTGTGCTTGAAACGGCCATCACCAGC
TTGAATCCAGAGGAGCAGGTCGAGCTTGTGAAGGGCATGGCTCGCTACCTCGGTAACCAGGGAGTTGTGTCAGAA
CAGGTTCTGGGCTGTATTGACCAAGTCATGAAGCGATGA
Gene >Hirsu2|5339
ATGGGCCGGACGAGGAGAGGCGTCAGATTCCCGCACGGCGCTGCCGGCGCGTCCGTCAACGGCCATGCCAGCGGC
TCCGAAGGCCATCGCTCCAGCTTCAGCGGCTCCGAGGACGGCTCCGGGTCGCCTTCGAGGACCCGGATCAAGTCG
CAGGCACAGCTGGCTCCCGTGCAGGAGGTATTTCCCCTTGTCCTTCACCTCGCCCACCGCCCTCGCTGTTCGCCG
CTTACGTGCAATGCAGAAGCAGCCGACGGCCGAGGAAGAGTACCAGAAGAAAAAGGCAAACTTCATGACGCGCAC
CTTCTGGACCTTCAGCATGCTCGCCATGTTCTTCACTGCCCTCTTCATGGGCCACATATACATCATAGCCATCGT
GACCGCCGTCCAGATTGTCTCCTTCAAGGAGGTCATCGCCATCGCCAACGTCCCCAGCCGCGCTCGATCCATCCG
CTCCACCAAGAGCCTCAACTGGTACTGGCTCGCCTCCACCATGTACTTTCTCTACGGCGAGAGCGTCATCTACTA
CTTCAAGCATGTCGTCCTCGTCGACAAGGTCTTGCTGCCCCTAGCCACTCACCACCGCTTCATCAGCTTCATCCT
CTACGTCTTCGGTCAGTCGTCTCCCCGCTCCCTGAAGCCCTGACCGCGTGCCGGACTGACATGCAGCCCCTAGGC
TTCGTCTGCTTCGTCGCTACTCTCAAGGCCGGCCATTACAAATTCCAGTTCACCAACTTCGCCTGGACACACATG
GCGCTCTACCTCATCGTCGTGCAAGCCCACTTTGTCATGAACAATGTTTTCGAGGGCATGATCTGGTTTTTCCTG
CCCGCCGCTCTCGTCATCACAAACGACATATTTGCCTACATCTGTGGCATCGCTTTCGGTCGCACCCAGCTCATC
AAGCTGTCCCCTAAGAAGACGGTTGAGGGTTTTGTGGGAGCCTGGATCATGACTATTCTCTTCGGCATGCTACTC
GTCAACCTCATGATTCGCTCCAAATATTTCATTTGCCCCGTCAATGTAGGTCGCCGTTGGCCTTGGAACATCAAG
GCATTCCGTGCCACTGACTCGCGGCTCGCAGGATCTCGGCGCCAACATCTTCACCGGCCTTGAGTGCGATCCGAA
CCCCGTCTTCGTCCCTCGTACCTACCATCTGCCGCAGCTATTCTTCTTGCCGCAAAACACGACTTTCTCGCTCAC
CTTCGCCCCCATGCAACTGCACACGTTGGTCCTCGCCTCGTTTGCCTCTCTAATCGCGCCTTTCGGTGGCTTCTT
CGCTTCCGGCCTGAAGCGGACCTTCAAGATCAAGGATTTTGGCGATTCCATTCCCGGCCACGGCGGCATGACGGA
TCGTATGGACTGCCAGTTCATCATGGGCTTATTCGCCTTCATGTACTACCACACCTTCATCGAGGTCCACAAGGT
CACCTTGGGCTCTGTGCTTGAAACGGCCATCACCAGCTTGAATCCAGAGGAGCAGGTCGAGCTTGTGAAGGGCAT
GGCTCGCTACCTCGGTAACCAGGGAGTTGTGTCAGAACAGGTAAGCATGGGTAGCTGAGCAGGCTCTATTCACTC
CCCTGTCCGAATTCTGCGTCCGGCTTCCCCGCCCCGTTATCAAACCGTGACACGACCTTCTTTACTGACTTGGTA
CCGTAGGTTCTGGGCTGTATTGACCAAGTCATGAAGCGATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail