Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5334
Gene name
LocationContig_2668:114..852
Strand+
Gene length (bp)738
Transcript length (bp)738
Coding sequence length (bp)738
Protein length (aa) 246

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07842 GCFC GC-rich sequence DNA-binding factor-like protein 7.9E-54 1 195

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTK6|YKR3_SCHPO G-patch domain-containing protein C1486.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1486.03c PE=3 SV=1 6 243 2.0E-27
sp|Q0IIX9|TFP11_XENTR Tuftelin-interacting protein 11 OS=Xenopus tropicalis GN=tfip11 PE=2 SV=2 1 243 1.0E-21
sp|Q66J74|TFP11_XENLA Tuftelin-interacting protein 11 OS=Xenopus laevis GN=tfip11 PE=2 SV=1 1 243 2.0E-20
sp|Q5U2Y6|TFP11_RAT Tuftelin-interacting protein 11 OS=Rattus norvegicus GN=Tfip11 PE=1 SV=1 1 243 3.0E-20
sp|Q9ERA6|TFP11_MOUSE Tuftelin-interacting protein 11 OS=Mus musculus GN=Tfip11 PE=1 SV=1 1 243 3.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTK6|YKR3_SCHPO G-patch domain-containing protein C1486.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1486.03c PE=3 SV=1 6 243 2.0E-27
sp|Q0IIX9|TFP11_XENTR Tuftelin-interacting protein 11 OS=Xenopus tropicalis GN=tfip11 PE=2 SV=2 1 243 1.0E-21
sp|Q66J74|TFP11_XENLA Tuftelin-interacting protein 11 OS=Xenopus laevis GN=tfip11 PE=2 SV=1 1 243 2.0E-20
sp|Q5U2Y6|TFP11_RAT Tuftelin-interacting protein 11 OS=Rattus norvegicus GN=Tfip11 PE=1 SV=1 1 243 3.0E-20
sp|Q9ERA6|TFP11_MOUSE Tuftelin-interacting protein 11 OS=Mus musculus GN=Tfip11 PE=1 SV=1 1 243 3.0E-20
sp|A4UMC5|TFP11_RABIT Tuftelin-interacting protein 11 OS=Oryctolagus cuniculus GN=TFIP11 PE=2 SV=1 1 243 7.0E-20
sp|Q5ZII9|TFP11_CHICK Tuftelin-interacting protein 11 OS=Gallus gallus GN=TFIP11 PE=2 SV=1 1 243 2.0E-19
sp|Q9UBB9|TFP11_HUMAN Tuftelin-interacting protein 11 OS=Homo sapiens GN=TFIP11 PE=1 SV=1 6 243 2.0E-19
sp|Q5R5K8|TFP11_PONAB Tuftelin-interacting protein 11 OS=Pongo abelii GN=TFIP11 PE=2 SV=1 6 243 2.0E-19
sp|A1XD93|TFP11_PANTR Tuftelin-interacting protein 11 OS=Pan troglodytes GN=TFIP11 PE=2 SV=1 6 243 2.0E-19
sp|A1XD94|TFP11_MACMU Tuftelin-interacting protein 11 OS=Macaca mulatta GN=TFIP11 PE=2 SV=1 6 243 2.0E-19
sp|Q6DI35|TFP11_DANRE Tuftelin-interacting protein 11 OS=Danio rerio GN=tfip11 PE=1 SV=1 1 243 3.0E-19
sp|A1XD95|TFP11_MACFA Tuftelin-interacting protein 11 OS=Macaca fascicularis GN=TFIP11 PE=2 SV=1 6 243 3.0E-19
sp|Q06AK6|TFP11_PIG Tuftelin-interacting protein 11 OS=Sus scrofa GN=TFIP11 PE=2 SV=1 6 243 4.0E-19
sp|A4UMC6|TFP11_MONDO Tuftelin-interacting protein 11 OS=Monodelphis domestica GN=TFIP11 PE=2 SV=1 1 243 5.0E-19
sp|Q9SLC6|STIP2_ARATH Septin and tuftelin-interacting protein 1 homolog 2 OS=Arabidopsis thaliana GN=STIPL2 PE=2 SV=1 7 227 5.0E-19
sp|A1XD97|TFP11_CANLF Tuftelin-interacting protein 11 OS=Canis lupus familiaris GN=TFIP11 PE=2 SV=1 6 243 6.0E-19
sp|Q29RR5|TFP11_BOVIN Tuftelin-interacting protein 11 OS=Bos taurus GN=TFIP11 PE=2 SV=2 1 243 1.0E-18
sp|Q9SHG6|STIP1_ARATH Septin and tuftelin-interacting protein 1 homolog 1 OS=Arabidopsis thaliana GN=STIPL1 PE=2 SV=1 7 242 2.0E-15
sp|Q17784|TFP11_CAEEL Septin and tuftelin-interacting protein 1 homolog OS=Caenorhabditis elegans GN=stip-1 PE=1 SV=2 7 220 6.0E-11
sp|A1XDC0|TFP11_DICDI Septin and tuftelin-interacting protein 1 homolog OS=Dictyostelium discoideum GN=stip-1 PE=2 SV=1 1 228 2.0E-09
sp|Q9Y103|TFP11_DROME Septin-interacting protein 1 OS=Drosophila melanogaster GN=sip1 PE=1 SV=1 7 243 9.0E-09
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal|Nuclear export signal 0.6531 0.5876 0.561 0.0559 0.2421 0.032 0.2115 0.2827 0.4883 0.2203

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3073
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3935
Ophiocordyceps australis map64 (Brazil) OphauB2|7979
Ophiocordyceps camponoti-floridani Ophcf2|00647
Ophiocordyceps camponoti-rufipedis Ophun1|2023
Ophiocordyceps kimflemingae Ophio5|4138
Ophiocordyceps subramaniannii Hirsu2|5334 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5334
MMYKNWLPQVLAAVRRWDALQPGPMLGVMESWDELLPPFVRAQVVGQVVRKLEAAVADWNPRKKRQSQQPPHSWL
FPWLPFLPAHQLDAKGTGLVAEVRRKFRQLIDVWEFERGVVPGLQPWQEVLGGEWRRLMMSHVLPAMGKYLRANF
RVDPADQEPYLGVLTGVLAWEPMLGGGVLGEVVAQNVLPMWNAKLQEWLALDEADLGEVAEWYGWWRGVVLKDLA
ASEGAVGHELDKGLRIMNLV*
Coding >Hirsu2|5334
ATGATGTACAAGAACTGGCTGCCCCAGGTCCTGGCCGCGGTCCGCCGGTGGGACGCCCTCCAGCCGGGCCCGATG
CTCGGCGTCATGGAGAGCTGGGACGAGCTCCTGCCCCCGTTTGTGCGGGCCCAGGTGGTGGGCCAGGTGGTGCGC
AAGCTCGAGGCGGCCGTGGCGGACTGGAACCCGAGGAAGAAGCGGCAGAGCCAGCAGCCGCCGCACAGCTGGCTG
TTCCCGTGGCTGCCGTTCCTGCCCGCCCACCAGCTGGACGCCAAAGGCACGGGCCTGGTGGCGGAGGTGAGGCGA
AAGTTCCGGCAGCTGATCGACGTGTGGGAGTTTGAGCGGGGGGTCGTGCCCGGGCTGCAGCCGTGGCAAGAGGTG
CTGGGCGGCGAATGGCGGCGGCTGATGATGTCGCACGTGCTGCCGGCGATGGGCAAGTATCTGCGGGCCAACTTT
CGCGTGGACCCGGCGGATCAGGAGCCGTACCTGGGCGTCCTGACGGGCGTGCTGGCGTGGGAGCCGATGCTGGGC
GGCGGCGTGCTGGGCGAGGTGGTGGCGCAGAACGTGCTGCCGATGTGGAACGCGAAGCTGCAGGAGTGGCTCGCG
CTCGACGAGGCGGACCTGGGCGAGGTGGCCGAGTGGTACGGCTGGTGGAGGGGCGTGGTGCTCAAGGACCTGGCC
GCGAGCGAGGGCGCCGTCGGCCACGAGCTGGACAAGGGCCTGCGGATCATGAACCTGGTGTGA
Transcript >Hirsu2|5334
ATGATGTACAAGAACTGGCTGCCCCAGGTCCTGGCCGCGGTCCGCCGGTGGGACGCCCTCCAGCCGGGCCCGATG
CTCGGCGTCATGGAGAGCTGGGACGAGCTCCTGCCCCCGTTTGTGCGGGCCCAGGTGGTGGGCCAGGTGGTGCGC
AAGCTCGAGGCGGCCGTGGCGGACTGGAACCCGAGGAAGAAGCGGCAGAGCCAGCAGCCGCCGCACAGCTGGCTG
TTCCCGTGGCTGCCGTTCCTGCCCGCCCACCAGCTGGACGCCAAAGGCACGGGCCTGGTGGCGGAGGTGAGGCGA
AAGTTCCGGCAGCTGATCGACGTGTGGGAGTTTGAGCGGGGGGTCGTGCCCGGGCTGCAGCCGTGGCAAGAGGTG
CTGGGCGGCGAATGGCGGCGGCTGATGATGTCGCACGTGCTGCCGGCGATGGGCAAGTATCTGCGGGCCAACTTT
CGCGTGGACCCGGCGGATCAGGAGCCGTACCTGGGCGTCCTGACGGGCGTGCTGGCGTGGGAGCCGATGCTGGGC
GGCGGCGTGCTGGGCGAGGTGGTGGCGCAGAACGTGCTGCCGATGTGGAACGCGAAGCTGCAGGAGTGGCTCGCG
CTCGACGAGGCGGACCTGGGCGAGGTGGCCGAGTGGTACGGCTGGTGGAGGGGCGTGGTGCTCAAGGACCTGGCC
GCGAGCGAGGGCGCCGTCGGCCACGAGCTGGACAAGGGCCTGCGGATCATGAACCTGGTGTGA
Gene >Hirsu2|5334
ATGATGTACAAGAACTGGCTGCCCCAGGTCCTGGCCGCGGTCCGCCGGTGGGACGCCCTCCAGCCGGGCCCGATG
CTCGGCGTCATGGAGAGCTGGGACGAGCTCCTGCCCCCGTTTGTGCGGGCCCAGGTGGTGGGCCAGGTGGTGCGC
AAGCTCGAGGCGGCCGTGGCGGACTGGAACCCGAGGAAGAAGCGGCAGAGCCAGCAGCCGCCGCACAGCTGGCTG
TTCCCGTGGCTGCCGTTCCTGCCCGCCCACCAGCTGGACGCCAAAGGCACGGGCCTGGTGGCGGAGGTGAGGCGA
AAGTTCCGGCAGCTGATCGACGTGTGGGAGTTTGAGCGGGGGGTCGTGCCCGGGCTGCAGCCGTGGCAAGAGGTG
CTGGGCGGCGAATGGCGGCGGCTGATGATGTCGCACGTGCTGCCGGCGATGGGCAAGTATCTGCGGGCCAACTTT
CGCGTGGACCCGGCGGATCAGGAGCCGTACCTGGGCGTCCTGACGGGCGTGCTGGCGTGGGAGCCGATGCTGGGC
GGCGGCGTGCTGGGCGAGGTGGTGGCGCAGAACGTGCTGCCGATGTGGAACGCGAAGCTGCAGGAGTGGCTCGCG
CTCGACGAGGCGGACCTGGGCGAGGTGGCCGAGTGGTACGGCTGGTGGAGGGGCGTGGTGCTCAAGGACCTGGCC
GCGAGCGAGGGCGCCGTCGGCCACGAGCTGGACAAGGGCCTGCGGATCATGAACCTGGTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail