Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5330
Gene name
LocationContig_2664:1333..2004
Strand+
Gene length (bp)671
Transcript length (bp)525
Coding sequence length (bp)525
Protein length (aa) 175

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06766 Hydrophobin_2 Fungal hydrophobin 1.8E-26 107 171

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UVI4|THYD_CLAFS Trihydrophobin OS=Claviceps fusiformis GN=TH1 PE=1 SV=1 107 172 6.0E-21
sp|Q9UVI4|THYD_CLAFS Trihydrophobin OS=Claviceps fusiformis GN=TH1 PE=1 SV=1 107 169 1.0E-18
sp|P52755|QID3_TRIHA Cell wall protein qid3 OS=Trichoderma harzianum GN=qid3 PE=2 SV=1 105 172 8.0E-18
sp|P52753|CRYP_CRYPA Cryparin OS=Cryphonectria parasitica GN=CRP PE=1 SV=1 107 172 9.0E-18
sp|P52754|HYP1_HYPJE Hydrophobin-1 OS=Hypocrea jecorina GN=hfb1 PE=1 SV=1 101 168 6.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UVI4|THYD_CLAFS Trihydrophobin OS=Claviceps fusiformis GN=TH1 PE=1 SV=1 107 172 6.0E-21
sp|Q9UVI4|THYD_CLAFS Trihydrophobin OS=Claviceps fusiformis GN=TH1 PE=1 SV=1 107 169 1.0E-18
sp|P52755|QID3_TRIHA Cell wall protein qid3 OS=Trichoderma harzianum GN=qid3 PE=2 SV=1 105 172 8.0E-18
sp|P52753|CRYP_CRYPA Cryparin OS=Cryphonectria parasitica GN=CRP PE=1 SV=1 107 172 9.0E-18
sp|P52754|HYP1_HYPJE Hydrophobin-1 OS=Hypocrea jecorina GN=hfb1 PE=1 SV=1 101 168 6.0E-16
sp|Q9UVI4|THYD_CLAFS Trihydrophobin OS=Claviceps fusiformis GN=TH1 PE=1 SV=1 107 168 6.0E-15
sp|Q06153|CEUL_OPHUL Cerato-ulmin OS=Ophiostoma ulmi GN=CU PE=1 SV=1 107 172 5.0E-14
sp|Q5UPJ3|YL116_MIMIV Uncharacterized protein L116 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L116 PE=3 SV=1 25 81 1.0E-10
sp|P79073|HYP2_HYPJE Hydrophobin-2 OS=Hypocrea jecorina GN=hfb2 PE=1 SV=1 105 172 3.0E-10
sp|Q5UPJ3|YL116_MIMIV Uncharacterized protein L116 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L116 PE=3 SV=1 31 81 8.0E-09
sp|Q5UPJ3|YL116_MIMIV Uncharacterized protein L116 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L116 PE=3 SV=1 25 79 2.0E-08
sp|Q5UPJ3|YL116_MIMIV Uncharacterized protein L116 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L116 PE=3 SV=1 29 81 6.0E-07
sp|Q5UPJ3|YL116_MIMIV Uncharacterized protein L116 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L116 PE=3 SV=1 25 81 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005576 extracellular region Yes
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5330
MKFLTVASLLFAGALAVPVDHNAGYDSPGGSVYGSPSGSGYGSPSGSGYNSPGRSGYNSPGRSGYYSPGRSGYNS
PGRSGYSNGGVFGGGVTPGNGGAPGNGGKSLCAAGLYSSPQCCSTDVLGVAGLDCKAPSSGPTDLAGFKGICGAA
GKSARCCVLPVAGQDVLCTDPLPA*
Coding >Hirsu2|5330
ATGAAGTTCCTTACCGTTGCGTCTCTTCTTTTCGCCGGCGCCCTGGCGGTTCCTGTCGACCATAATGCAGGGTAC
GATTCGCCTGGCGGCTCAGTGTACGGTTCGCCAAGTGGTTCAGGTTACGGTTCTCCTAGCGGTTCAGGGTACAAC
TCGCCTGGCCGATCGGGTTACAACTCGCCTGGCCGTTCGGGTTACTACTCGCCTGGCCGTTCGGGCTACAACTCG
CCTGGCCGTTCAGGGTACAGCAACGGGGGGGTATTCGGTGGCGGTGTCACGCCCGGAAACGGAGGCGCTCCCGGG
AACGGCGGGAAAAGTCTCTGCGCAGCTGGACTTTATAGCAGTCCTCAGTGCTGCAGCACCGATGTCCTTGGGGTT
GCAGGCCTTGACTGCAAGGCACCTTCTTCCGGCCCGACCGACTTAGCGGGATTTAAGGGCATATGTGGCGCCGCC
GGCAAGTCAGCTAGGTGCTGCGTTCTTCCTGTGGCCGGCCAGGATGTGCTCTGCACCGACCCGCTTCCTGCGTAG
Transcript >Hirsu2|5330
ATGAAGTTCCTTACCGTTGCGTCTCTTCTTTTCGCCGGCGCCCTGGCGGTTCCTGTCGACCATAATGCAGGGTAC
GATTCGCCTGGCGGCTCAGTGTACGGTTCGCCAAGTGGTTCAGGTTACGGTTCTCCTAGCGGTTCAGGGTACAAC
TCGCCTGGCCGATCGGGTTACAACTCGCCTGGCCGTTCGGGTTACTACTCGCCTGGCCGTTCGGGCTACAACTCG
CCTGGCCGTTCAGGGTACAGCAACGGGGGGGTATTCGGTGGCGGTGTCACGCCCGGAAACGGAGGCGCTCCCGGG
AACGGCGGGAAAAGTCTCTGCGCAGCTGGACTTTATAGCAGTCCTCAGTGCTGCAGCACCGATGTCCTTGGGGTT
GCAGGCCTTGACTGCAAGGCACCTTCTTCCGGCCCGACCGACTTAGCGGGATTTAAGGGCATATGTGGCGCCGCC
GGCAAGTCAGCTAGGTGCTGCGTTCTTCCTGTGGCCGGCCAGGATGTGCTCTGCACCGACCCGCTTCCTGCGTAG
Gene >Hirsu2|5330
ATGAAGTTCCTTACCGTTGCGTCTCTTCTTTTCGCCGGCGCCCTGGCGGTTCCTGTCGACCATAATGCAGGGTAC
GATTCGCCTGGCGGCTCAGTGTACGGTTCGCCAAGTGGTTCAGGTTACGGTTCTCCTAGCGGTTCAGGGTACAAC
TCGCCTGGCCGATCGGGTTACAACTCGCCTGGCCGTTCGGGTTACTACTCGCCTGGCCGTTCGGGCTACAACTCG
CCTGGCCGTTCAGGGTACAGCAACGGGGGGGTATTCGGTGGCGGTGTCACGCCCGGAAACGGAGGCGCTCCCGGG
AACGGCGGGAAAAGTCTCTGCGCAGCTGGACTTTATAGCAGTCCTCAGTGCTGCAGCACCGATGTCCTTGGGGTT
GCAGGCCTTGACTGCAAGGCACGTAAGTATACTGCCCACTACGTCCTCTCTTTATCCACTGTCCACACTCGAGCC
TAGCTAAACTGTCCCGAAGCTTCTTCCGGCCCGACCGACTTAGCGGGATTTAAGGGCATATGTGGCGCCGCCGGC
AAGTCAGCTAGGTGCTGCGTTCTTCCTGTGGTAAGTCATTGCGACGTCTCACAGAATACTATAAATAAGGATGCT
TAGATGACTGATTCCTCCACTCCATCCAGGCCGGCCAGGATGTGCTCTGCACCGACCCGCTTCCTGCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail