Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5320
Gene name
LocationContig_266:9950..11280
Strand+
Gene length (bp)1330
Transcript length (bp)1260
Coding sequence length (bp)1260
Protein length (aa) 420

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12231 Rif1_N Rap1-interacting factor 1 N terminal 3.5E-104 163 416

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q96UP3|RIF1_SCHPO Telomere length regulator protein rif1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rif1 PE=1 SV=1 103 419 2.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5320
MASPAASAPSIHILTSLPARPPTPPREASHDADLSLRPILLGRTYAFDPCHSLQTPPSANSHLSSAVAGSDAGSD
PGSRRLCKRVEWSSHTEYKDPPDYRDGTRLEKSPPLSAPPSASSRPIKGILKPSPSPSPFGSSFGTQLDGTIAQP
NLGEMLDSTIKQLAGPDRDSKLDAYMVLARALKTSNNLPDRVALQNKMSLFMQFIQRDITSKNQNGTLDSSLVNH
ALTLLATFLHFPAIASTITSDFGVFVIDHAIRSFEDPAMPKEVIRHLMQVVAFQNFSPKVMVSDRVGRLLAALHN
IEQHLKGKSIVMSRLHIYKRLVKQARNCVIAHSDWLKDMFTDMLSTVKDIRAQAISLGIEAGFALRSDKLLFRKV
AEIFKTADNDQTYIDFYIERLQRMIKDKQTASAVPQIWSVTRSI*
Coding >Hirsu2|5320
ATGGCATCTCCAGCAGCCTCGGCCCCATCCATACACATCCTCACCTCCCTTCCAGCCCGACCGCCGACTCCGCCG
CGCGAGGCCAGCCACGACGCCGACCTTTCCCTTCGGCCCATCCTGCTCGGAAGGACTTACGCTTTCGACCCCTGC
CACAGCCTCCAAACGCCTCCGAGCGCCAACTCACACCTGTCCTCCGCGGTCGCTGGCTCCGACGCGGGTTCCGAC
CCGGGCTCCAGGCGATTGTGCAAGAGGGTCGAGTGGTCCAGCCACACCGAGTACAAGGACCCTCCCGACTATCGT
GACGGGACCCGACTCGAAAAGTCTCCTCCCCTCTCCGCTCCGCCCTCGGCCTCGTCCAGGCCCATCAAGGGCATC
CTCAAGCCATCGCCGTCCCCCAGTCCTTTCGGCTCCTCGTTCGGTACCCAACTCGATGGCACCATCGCCCAGCCC
AACCTAGGCGAAATGCTCGACTCCACCATCAAACAGCTCGCCGGGCCCGATCGGGACTCCAAGCTGGATGCCTAT
ATGGTGCTTGCTAGAGCGTTGAAGACATCCAACAACCTCCCCGACCGTGTTGCGCTACAGAACAAAATGAGTCTG
TTCATGCAGTTCATCCAGCGCGACATCACATCCAAGAACCAGAACGGCACCCTTGACAGCTCCTTAGTCAACCAT
GCCCTTACTCTACTCGCCACCTTCCTTCATTTTCCTGCCATCGCCTCTACCATCACCTCGGACTTCGGCGTCTTC
GTCATCGATCACGCTATCCGGTCCTTTGAAGATCCCGCCATGCCCAAGGAAGTCATACGCCACCTGATGCAGGTT
GTCGCCTTCCAGAACTTCTCTCCAAAGGTAATGGTGTCAGACCGTGTTGGACGACTGCTTGCCGCTCTCCACAAC
ATCGAACAGCATCTGAAGGGTAAGAGCATAGTCATGAGCCGCTTGCACATCTACAAGCGGCTCGTCAAGCAGGCT
CGGAACTGCGTCATCGCTCACTCTGACTGGCTCAAGGACATGTTCACAGACATGCTCAGCACAGTCAAGGATATT
CGGGCCCAAGCCATTAGTCTCGGCATCGAGGCAGGCTTTGCCCTTCGGTCCGACAAGCTTCTGTTTCGAAAAGTT
GCCGAGATCTTCAAGACCGCAGACAATGATCAGACTTACATCGACTTTTATATCGAAAGGCTGCAACGAATGATC
AAGGACAAGCAGACTGCGTCTGCCGTACCTCAGATTTGGAGCGTTACGCGTTCAATATGA
Transcript >Hirsu2|5320
ATGGCATCTCCAGCAGCCTCGGCCCCATCCATACACATCCTCACCTCCCTTCCAGCCCGACCGCCGACTCCGCCG
CGCGAGGCCAGCCACGACGCCGACCTTTCCCTTCGGCCCATCCTGCTCGGAAGGACTTACGCTTTCGACCCCTGC
CACAGCCTCCAAACGCCTCCGAGCGCCAACTCACACCTGTCCTCCGCGGTCGCTGGCTCCGACGCGGGTTCCGAC
CCGGGCTCCAGGCGATTGTGCAAGAGGGTCGAGTGGTCCAGCCACACCGAGTACAAGGACCCTCCCGACTATCGT
GACGGGACCCGACTCGAAAAGTCTCCTCCCCTCTCCGCTCCGCCCTCGGCCTCGTCCAGGCCCATCAAGGGCATC
CTCAAGCCATCGCCGTCCCCCAGTCCTTTCGGCTCCTCGTTCGGTACCCAACTCGATGGCACCATCGCCCAGCCC
AACCTAGGCGAAATGCTCGACTCCACCATCAAACAGCTCGCCGGGCCCGATCGGGACTCCAAGCTGGATGCCTAT
ATGGTGCTTGCTAGAGCGTTGAAGACATCCAACAACCTCCCCGACCGTGTTGCGCTACAGAACAAAATGAGTCTG
TTCATGCAGTTCATCCAGCGCGACATCACATCCAAGAACCAGAACGGCACCCTTGACAGCTCCTTAGTCAACCAT
GCCCTTACTCTACTCGCCACCTTCCTTCATTTTCCTGCCATCGCCTCTACCATCACCTCGGACTTCGGCGTCTTC
GTCATCGATCACGCTATCCGGTCCTTTGAAGATCCCGCCATGCCCAAGGAAGTCATACGCCACCTGATGCAGGTT
GTCGCCTTCCAGAACTTCTCTCCAAAGGTAATGGTGTCAGACCGTGTTGGACGACTGCTTGCCGCTCTCCACAAC
ATCGAACAGCATCTGAAGGGTAAGAGCATAGTCATGAGCCGCTTGCACATCTACAAGCGGCTCGTCAAGCAGGCT
CGGAACTGCGTCATCGCTCACTCTGACTGGCTCAAGGACATGTTCACAGACATGCTCAGCACAGTCAAGGATATT
CGGGCCCAAGCCATTAGTCTCGGCATCGAGGCAGGCTTTGCCCTTCGGTCCGACAAGCTTCTGTTTCGAAAAGTT
GCCGAGATCTTCAAGACCGCAGACAATGATCAGACTTACATCGACTTTTATATCGAAAGGCTGCAACGAATGATC
AAGGACAAGCAGACTGCGTCTGCCGTACCTCAGATTTGGAGCGTTACGCGTTCAATATGA
Gene >Hirsu2|5320
ATGGCATCTCCAGCAGCCTCGGCCCCATCCATACACATCCTCACCTCCCTTCCAGCCCGACCGCCGACTCCGCCG
CGCGAGGCCAGCCACGACGCCGACCTTTCCCTTCGGCCCATCCTGCTCGGAAGGACTTACGCTTTCGACCCCTGC
CACAGCCTCCAAACGCCTCCGAGCGCCAACTCACACCTGTCCTCCGCGGTCGCTGGCTCCGACGCGGGTTCCGAC
CCGGGCTCCAGGCGATTGTGCAAGAGGGTCGAGTGGTCCAGCCACACCGAGTACAAGGACCCTCCCGACTATCGT
GACGGGACCCGACTCGAAAAGTCTCCTCCCCTCTCCGCTCCGCCCTCGGCCTCGTCCAGGCCCATCAAGGGCATC
CTCAAGCCATCGCCGTCCCCCAGTCCTTTCGGCTCCTCGTTCGGTACCCAACTCGATGGCACCATCGCCCAGCCC
AACCTAGGCGAAATGCTCGACTCCACCATCAAACAGCTCGCCGGGCCCGATCGGGACTCCAAGCTGGATGCCTAT
ATGGTGCTTGCTAGAGCGTTGAAGACATCCAACAACCTCCCCGACCGTGTTGCGCTACAGAACAAAATGAGTCTG
TTCATGCAGTTCATCCAGCGCGACATCACATCCAAGAACCAGAACGGCACCCTTGACAGCTCCTTAGTCAACCAT
GCCCTTACTCTACTCGCCACCTTCCTTCATTTTCCTGCCATCGCCTCTACCATCACCTCGGACTTCGGCGTCTTC
GTCATCGATCACGCTATCCGGTCCTTTGAAGATCCCGCCATGCCCAAGGAAGTCATACGCCACCTGATGCAGGTT
GTCGCCTTCCAGAACTTCTCTCCAAAGGTAATGGTGTCAGACCGTGTTGGACGACTGCTTGCCGCTCTCCACAAC
ATCGAACAGCATCTGAAGGGTAAGAGCATAGTCATGAGCCGCTTGCACATCTACAAGCGGCTCGTCAAGCAGGCT
CGGAACTGCGTCATCGCTCACTCTGACTGGCTCAAGGACATGTTCACAGACATGCTCAGCACAGTCAAGGATATT
CGGGCCCAAGCCATTAGTCTCGGCATCGAGGCAGGCTTTGCCCTTCGGTCCGACAAGCTTCTGTTTCGAAAAGTT
GCCGAGATCTTCAAGACCGCAGACAATGATCAGACTTACATCGACTTTTATATCGAAAGGCTGCAACGAATGATC
AAGGACAAGCAGACTGCGTCTGCCGTACCTCAGATTTGGAGCGTTGTTATTCTCTTTTTGCGACACCCGCTCGAC
AGATGGCTATACTACGGCCCTTGGCTGACAATCATCCAAGACGCGTTCAATATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail