Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5307
Gene name
LocationContig_2650:58..970
Strand+
Gene length (bp)912
Transcript length (bp)912
Coding sequence length (bp)912
Protein length (aa) 304

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 1.2E-37 16 247

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A2QQV6|QUTD_ASPNC Probable quinate permease OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=qutD PE=3 SV=1 1 284 2.0E-29
sp|Q4U3U4|QAY_NEUTR Quinate permease OS=Neurospora terricola GN=qa-y PE=3 SV=1 23 281 4.0E-28
sp|Q2U2Y9|QUTD_ASPOR Probable quinate permease OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=qutD PE=3 SV=1 1 270 7.0E-27
sp|B8NIM7|QUTD_ASPFN Probable quinate permease OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=qutD PE=3 SV=1 1 270 7.0E-27
sp|P15325|QUTD_EMENI Quinate permease OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=qutD PE=1 SV=2 1 277 2.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A2QQV6|QUTD_ASPNC Probable quinate permease OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=qutD PE=3 SV=1 1 284 2.0E-29
sp|Q4U3U4|QAY_NEUTR Quinate permease OS=Neurospora terricola GN=qa-y PE=3 SV=1 23 281 4.0E-28
sp|Q2U2Y9|QUTD_ASPOR Probable quinate permease OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=qutD PE=3 SV=1 1 270 7.0E-27
sp|B8NIM7|QUTD_ASPFN Probable quinate permease OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=qutD PE=3 SV=1 1 270 7.0E-27
sp|P15325|QUTD_EMENI Quinate permease OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=qutD PE=1 SV=2 1 277 2.0E-26
sp|Q6MYX6|QUTD_ASPFU Probable quinate permease OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=qutD PE=3 SV=1 1 294 3.0E-26
sp|Q4U3U6|QAY_NEUAF Quinate permease OS=Neurospora africana GN=qa-y PE=3 SV=1 28 281 4.0E-26
sp|P11636|QAY_NEUCR Quinate permease OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=qa-y PE=3 SV=2 23 281 2.0E-25
sp|Q0D135|QUTD_ASPTN Probable quinate permease OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=qutD PE=3 SV=1 1 299 2.0E-25
sp|A1CPX0|QUTD_ASPCL Probable quinate permease OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=qutD PE=3 SV=1 1 297 1.0E-23
sp|B0XQS8|QUTD_ASPFC Probable quinate permease OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=qutD PE=3 SV=1 1 294 5.0E-20
sp|A1D2R3|QUTD_NEOFI Probable quinate permease OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=qutD PE=3 SV=1 3 294 3.0E-19
sp|Q8VZ80|PLT5_ARATH Polyol transporter 5 OS=Arabidopsis thaliana GN=PLT5 PE=1 SV=2 36 281 1.0E-16
sp|A9ZSY2|TRET1_APILI Facilitated trehalose transporter Tret1 OS=Apis mellifera ligustica GN=Tret1 PE=1 SV=1 15 259 5.0E-16
sp|P07921|LACP_KLULA Lactose permease OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LAC12 PE=3 SV=1 17 250 1.0E-15
sp|B4MYA4|TRET1_DROWI Facilitated trehalose transporter Tret1 OS=Drosophila willistoni GN=Tret1 PE=3 SV=1 22 245 3.0E-15
sp|P96710|ARAE_BACSU Arabinose-proton symporter OS=Bacillus subtilis (strain 168) GN=araE PE=2 SV=2 3 246 8.0E-15
sp|Q17NV8|TRET1_AEDAE Facilitated trehalose transporter Tret1 OS=Aedes aegypti GN=Tret1 PE=3 SV=1 22 245 1.0E-14
sp|Q0WUU6|PLT4_ARATH Probable polyol transporter 4 OS=Arabidopsis thaliana GN=PLT4 PE=2 SV=1 36 248 1.0E-14
sp|P45598|ARAE_KLEOX Arabinose-proton symporter OS=Klebsiella oxytoca GN=araE PE=3 SV=1 20 245 1.0E-14
sp|P0AE24|ARAE_ECOLI Arabinose-proton symporter OS=Escherichia coli (strain K12) GN=araE PE=1 SV=1 20 245 1.0E-14
sp|P0AE25|ARAE_ECO57 Arabinose-proton symporter OS=Escherichia coli O157:H7 GN=araE PE=3 SV=1 20 245 1.0E-14
sp|Q93Y91|STP5_ARATH Sugar transport protein 5 OS=Arabidopsis thaliana GN=STP5 PE=2 SV=1 19 252 2.0E-14
sp|B4P624|TRET1_DROYA Facilitated trehalose transporter Tret1 OS=Drosophila yakuba GN=Tret1 PE=3 SV=1 21 245 8.0E-14
sp|B4LPX5|TRET1_DROVI Facilitated trehalose transporter Tret1 OS=Drosophila virilis GN=Tret1 PE=3 SV=2 22 245 9.0E-14
sp|Q291H8|TRET1_DROPS Facilitated trehalose transporter Tret1 OS=Drosophila pseudoobscura pseudoobscura GN=Tret1 PE=3 SV=3 22 245 1.0E-13
sp|B4GAP7|TRET1_DROPE Facilitated trehalose transporter Tret1 OS=Drosophila persimilis GN=Tret1 PE=3 SV=2 22 245 1.0E-13
sp|P15686|HUP1_PARKE H(+)/hexose cotransporter 1 OS=Parachlorella kessleri GN=HUP1 PE=2 SV=2 22 276 1.0E-13
sp|Q9SBA7|STP8_ARATH Sugar transport protein 8 OS=Arabidopsis thaliana GN=STP8 PE=2 SV=2 35 274 2.0E-13
sp|Q07423|HEX6_RICCO Hexose carrier protein HEX6 OS=Ricinus communis GN=HEX6 PE=2 SV=1 25 266 3.0E-13
sp|P39003|HXT6_YEAST High-affinity hexose transporter HXT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT6 PE=1 SV=2 19 272 3.0E-13
sp|B0WC46|TRET1_CULQU Facilitated trehalose transporter Tret1 OS=Culex quinquefasciatus GN=Tret1 PE=3 SV=1 22 245 5.0E-13
sp|Q7PIR5|TRET1_ANOGA Facilitated trehalose transporter Tret1 OS=Anopheles gambiae GN=Tret1 PE=1 SV=3 21 245 5.0E-13
sp|A9ZSY3|TRET1_BOMMO Facilitated trehalose transporter Tret1 OS=Bombyx mori GN=Tret1 PE=1 SV=1 18 244 5.0E-13
sp|B4J913|TRET1_DROGR Facilitated trehalose transporter Tret1 OS=Drosophila grimshawi GN=Tret1 PE=3 SV=1 21 245 7.0E-13
sp|B4KR05|TRET1_DROMO Facilitated trehalose transporter Tret1 OS=Drosophila mojavensis GN=Tret1 PE=3 SV=2 21 245 9.0E-13
sp|Q9SFG0|STP6_ARATH Sugar transport protein 6 OS=Arabidopsis thaliana GN=STP6 PE=1 SV=1 35 276 1.0E-12
sp|P39004|HXT7_YEAST High-affinity hexose transporter HXT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT7 PE=1 SV=1 19 272 1.0E-12
sp|Q39525|HUP3_PARKE H(+)/hexose cotransporter 3 OS=Parachlorella kessleri GN=HUP3 PE=2 SV=1 22 278 1.0E-12
sp|P23586|STP1_ARATH Sugar transport protein 1 OS=Arabidopsis thaliana GN=STP1 PE=1 SV=2 25 284 2.0E-12
sp|B3MG58|TRET1_DROAN Facilitated trehalose transporter Tret1 OS=Drosophila ananassae GN=Tret1 PE=3 SV=2 22 245 2.0E-12
sp|P13181|GAL2_YEAST Galactose transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAL2 PE=1 SV=3 19 272 3.0E-12
sp|Q9ZNS0|PLT3_ARATH Probable polyol transporter 3 OS=Arabidopsis thaliana GN=PLT3 PE=3 SV=1 18 247 4.0E-12
sp|P0AGF4|XYLE_ECOLI D-xylose-proton symporter OS=Escherichia coli (strain K12) GN=xylE PE=1 SV=1 34 248 9.0E-12
sp|P0AGF5|XYLE_ECO57 D-xylose-proton symporter OS=Escherichia coli O157:H7 GN=xylE PE=3 SV=1 34 248 9.0E-12
sp|B3NSE1|TRET1_DROER Facilitated trehalose transporter Tret1 OS=Drosophila erecta GN=Tret1 PE=3 SV=1 21 245 9.0E-12
sp|B4QBN2|TRE11_DROSI Facilitated trehalose transporter Tret1-1 OS=Drosophila simulans GN=Tret1-1 PE=3 SV=2 2 245 1.0E-11
sp|Q9FMX3|STP11_ARATH Sugar transport protein 11 OS=Arabidopsis thaliana GN=STP11 PE=1 SV=1 22 246 1.0E-11
sp|P0AEP1|GALP_ECOLI Galactose-proton symporter OS=Escherichia coli (strain K12) GN=galP PE=1 SV=1 20 245 1.0E-11
sp|P0AEP2|GALP_ECOL6 Galactose-proton symporter OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=galP PE=3 SV=1 20 245 1.0E-11
sp|Q6AWX0|XYLL2_ARATH D-xylose-proton symporter-like 2 OS=Arabidopsis thaliana GN=At5g17010 PE=1 SV=1 38 244 2.0E-11
sp|Q94AZ2|STP13_ARATH Sugar transport protein 13 OS=Arabidopsis thaliana GN=STP13 PE=1 SV=2 5 252 2.0E-11
sp|O74713|HGT1_CANAX High-affinity glucose transporter OS=Candida albicans GN=HGT1 PE=3 SV=1 24 248 2.0E-11
sp|A1Z8N1|TRE11_DROME Facilitated trehalose transporter Tret1-1 OS=Drosophila melanogaster GN=Tret1-1 PE=1 SV=1 38 245 3.0E-11
sp|B4HNS0|TRE11_DROSE Facilitated trehalose transporter Tret1-1 OS=Drosophila sechellia GN=Tret1-1 PE=3 SV=1 38 245 3.0E-11
sp|P87110|ITR2_SCHPO Myo-inositol transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itr2 PE=2 SV=1 6 248 3.0E-11
sp|B4HNS1|TRE12_DROSE Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila sechellia GN=Tret1-2 PE=3 SV=1 6 245 4.0E-11
sp|Q0WWW9|XYLL3_ARATH D-xylose-proton symporter-like 3, chloroplastic OS=Arabidopsis thaliana GN=At5g59250 PE=2 SV=2 38 244 4.0E-11
sp|Q8L7R8|STP3_ARATH Sugar transport protein 3 OS=Arabidopsis thaliana GN=STP3 PE=2 SV=2 22 269 5.0E-11
sp|Q94AF9|EDL11_ARATH Sugar transporter ERD6-like 11 OS=Arabidopsis thaliana GN=At3g05165 PE=2 SV=2 18 244 5.0E-11
sp|Q39228|STP4_ARATH Sugar transport protein 4 OS=Arabidopsis thaliana GN=STP4 PE=1 SV=1 29 252 7.0E-11
sp|Q8L6Z8|XYLL1_ARATH D-xylose-proton symporter-like 1 OS=Arabidopsis thaliana GN=At3g03090 PE=2 SV=1 38 244 7.0E-11
sp|Q9LT15|STP10_ARATH Sugar transport protein 10 OS=Arabidopsis thaliana GN=STP10 PE=2 SV=1 28 252 9.0E-11
sp|O65413|STP12_ARATH Sugar transport protein 12 OS=Arabidopsis thaliana GN=STP12 PE=2 SV=1 25 252 1.0E-10
sp|Q8GXR2|PLT6_ARATH Probable polyol transporter 6 OS=Arabidopsis thaliana GN=PLT6 PE=2 SV=2 29 248 2.0E-10
sp|Q8MKK4|TRE12_DROME Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila melanogaster GN=Tret1-2 PE=2 SV=1 2 245 2.0E-10
sp|Q9JJZ1|GTR8_RAT Solute carrier family 2, facilitated glucose transporter member 8 OS=Rattus norvegicus GN=Slc2a8 PE=1 SV=1 36 248 3.0E-10
sp|Q39524|HUP2_PARKE H(+)/hexose cotransporter 2 OS=Parachlorella kessleri GN=HUP2 PE=2 SV=1 32 296 3.0E-10
sp|Q41144|STC_RICCO Sugar carrier protein C OS=Ricinus communis GN=STC PE=2 SV=1 25 252 4.0E-10
sp|A5LGM7|TRET1_POLVA Facilitated trehalose transporter Tret1 OS=Polypedilum vanderplanki GN=Tret1 PE=1 SV=1 22 245 4.0E-10
sp|Q94CI7|EDL17_ARATH Sugar transporter ERD6-like 17 OS=Arabidopsis thaliana GN=SFP1 PE=2 SV=2 28 244 4.0E-10
sp|Q92253|RCO3_NEUCR Probable glucose transporter rco-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-3 PE=3 SV=2 29 248 4.0E-10
sp|Q9XIH6|PLT2_ARATH Putative polyol transporter 2 OS=Arabidopsis thaliana GN=PLT2 PE=3 SV=1 36 279 6.0E-10
sp|P30606|ITR2_YEAST Myo-inositol transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR2 PE=1 SV=2 17 279 9.0E-10
sp|C0SPB2|YWTG_BACSU Putative metabolite transport protein YwtG OS=Bacillus subtilis (strain 168) GN=ywtG PE=3 SV=1 38 245 9.0E-10
sp|P15729|GLCP_SYNY3 Glucose transport protein OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gtr PE=3 SV=2 3 243 1.0E-09
sp|B4QBN3|TRE12_DROSI Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila simulans GN=Tret1-2 PE=3 SV=1 19 245 1.0E-09
sp|Q94CI6|EDL18_ARATH Sugar transporter ERD6-like 18 OS=Arabidopsis thaliana GN=SFP2 PE=2 SV=1 18 244 1.0E-09
sp|P30605|ITR1_YEAST Myo-inositol transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR1 PE=1 SV=2 17 246 2.0E-09
sp|O04249|STP7_ARATH Sugar transport protein 7 OS=Arabidopsis thaliana GN=STP7 PE=2 SV=1 24 252 2.0E-09
sp|Q9NY64|GTR8_HUMAN Solute carrier family 2, facilitated glucose transporter member 8 OS=Homo sapiens GN=SLC2A8 PE=1 SV=3 22 248 2.0E-09
sp|Q12300|RGT2_YEAST High-affinity glucose transporter RGT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGT2 PE=1 SV=1 4 247 3.0E-09
sp|Q93Z80|EDL10_ARATH Sugar transporter ERD6-like 10 OS=Arabidopsis thaliana GN=At3g05160 PE=2 SV=1 18 244 3.0E-09
sp|Q9WV38|GTR5_MOUSE Solute carrier family 2, facilitated glucose transporter member 5 OS=Mus musculus GN=Slc2a5 PE=1 SV=2 1 269 4.0E-09
sp|Q9LNV3|STP2_ARATH Sugar transport protein 2 OS=Arabidopsis thaliana GN=STP2 PE=1 SV=3 18 243 5.0E-09
sp|Q9JIF3|GTR8_MOUSE Solute carrier family 2, facilitated glucose transporter member 8 OS=Mus musculus GN=Slc2a8 PE=1 SV=2 22 248 5.0E-09
sp|Q10710|STA_RICCO Sugar carrier protein A OS=Ricinus communis GN=STA PE=2 SV=1 22 252 5.0E-09
sp|P58354|GTR8_BOVIN Solute carrier family 2, facilitated glucose transporter member 8 OS=Bos taurus GN=SLC2A8 PE=2 SV=2 22 248 7.0E-09
sp|P39932|STL1_YEAST Sugar transporter STL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STL1 PE=1 SV=2 25 247 1.0E-08
sp|P58353|GTR5_BOVIN Solute carrier family 2, facilitated glucose transporter member 5 OS=Bos taurus GN=SLC2A5 PE=1 SV=2 3 269 1.0E-08
sp|P21906|GLF_ZYMMO Glucose facilitated diffusion protein OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=glf PE=3 SV=2 30 246 1.0E-08
sp|Q9SX48|STP9_ARATH Sugar transport protein 9 OS=Arabidopsis thaliana GN=STP9 PE=1 SV=1 18 253 2.0E-08
sp|P18631|RAG1_KLULA Low-affinity glucose transporter OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAG1 PE=1 SV=1 4 272 4.0E-08
sp|P10870|SNF3_YEAST High-affinity glucose transporter SNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF3 PE=1 SV=3 29 247 4.0E-08
sp|Q0WQ63|ERDL8_ARATH Sugar transporter ERD6-like 8 OS=Arabidopsis thaliana GN=At3g05150 PE=2 SV=1 22 246 4.0E-08
sp|Q9XIH7|PLT1_ARATH Putative polyol transporter 1 OS=Arabidopsis thaliana GN=PLT1 PE=3 SV=1 36 279 5.0E-08
sp|P94493|YNCC_BACSU Putative metabolite transport protein YncC OS=Bacillus subtilis (strain 168) GN=yncC PE=3 SV=2 36 247 5.0E-08
sp|O44827|FGT1_CAEEL Facilitated glucose transporter protein 1 OS=Caenorhabditis elegans GN=fgt-1 PE=1 SV=2 16 248 7.0E-08
sp|A6ZT02|HXT4_YEAS7 Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain YJM789) GN=HXT4 PE=3 SV=1 19 272 2.0E-07
sp|P32467|HXT4_YEAST Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT4 PE=1 SV=1 19 272 2.0E-07
sp|C7GWV6|HXT4_YEAS2 Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain JAY291) GN=HXT4 PE=3 SV=1 19 272 3.0E-07
sp|O74849|GHT6_SCHPO High-affinity fructose transporter ght6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght6 PE=1 SV=1 28 303 5.0E-07
sp|Q96290|MSSP1_ARATH Monosaccharide-sensing protein 1 OS=Arabidopsis thaliana GN=MSSP1 PE=1 SV=2 36 247 5.0E-07
sp|Q01440|GTR1_LEIDO Membrane transporter D1 OS=Leishmania donovani PE=3 SV=1 22 275 6.0E-07
sp|Q8WMN1|GTR5_SHEEP Solute carrier family 2, facilitated glucose transporter member 5 OS=Ovis aries GN=SLC2A5 PE=2 SV=1 3 269 7.0E-07
sp|Q9UGQ3|GTR6_HUMAN Solute carrier family 2, facilitated glucose transporter member 6 OS=Homo sapiens GN=SLC2A6 PE=1 SV=2 30 247 7.0E-07
sp|O59932|GHT4_SCHPO High-affinity hexose transporter ght4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght4 PE=3 SV=2 28 251 7.0E-07
sp|P42833|HXT14_YEAST Hexose transporter HXT14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT14 PE=1 SV=2 19 248 1.0E-06
sp|Q92339|GHT3_SCHPO High-affinity gluconate transporter ght3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght3 PE=3 SV=1 28 247 1.0E-06
sp|P43427|GTR5_RAT Solute carrier family 2, facilitated glucose transporter member 5 OS=Rattus norvegicus GN=Slc2a5 PE=1 SV=1 1 278 1.0E-06
sp|Q93YP9|ERDL4_ARATH Sugar transporter ERD6-like 4 OS=Arabidopsis thaliana GN=At1g19450 PE=2 SV=1 17 247 1.0E-06
sp|Q9SD00|MSSP3_ARATH Monosaccharide-sensing protein 3 OS=Arabidopsis thaliana GN=MSSP3 PE=2 SV=1 36 249 1.0E-06
sp|P43562|YFE0_YEAST Probable metabolite transport protein YFL040W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YFL040W PE=1 SV=1 36 293 2.0E-06
sp|Q8GW61|STP14_ARATH Sugar transport protein 14 OS=Arabidopsis thaliana GN=STP14 PE=2 SV=2 39 251 2.0E-06
sp|P93051|ERDL7_ARATH Sugar transporter ERD6-like 7 OS=Arabidopsis thaliana GN=At2g48020 PE=2 SV=2 16 248 2.0E-06
sp|P54723|YFIG_BACSU Putative metabolite transport protein YfiG OS=Bacillus subtilis (strain 168) GN=yfiG PE=3 SV=1 24 264 4.0E-06
sp|P46333|CSBC_BACSU Probable metabolite transport protein CsbC OS=Bacillus subtilis (strain 168) GN=csbC PE=1 SV=3 38 244 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0005215 transporter activity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.5

Transmembrane Domains

Domain # Start End Length
1 30 52 22
2 67 89 22
3 98 120 22
4 140 157 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5307
LDRELEATRGVGLLGKVKEMFMDRRNLYRVYLVTMVQLLSQWSGAGSITVYAPDLFRILGISGSEEGLLVTAVFG
IVKLVAALLCALFLVDVIGRKRALLSGITLQAVSIIYVAAFLTAVPQLGVDDDFVLPEDRKPASRGAIAMIYISG
CGWALGWNSMQYLLTAELFPLRIRALATSWAMTLHFANQYGNSRAVPNMLLPVDEGGISPKGTFWCFAAVTLLGG
LWVWLSVPETSGRSLENMDRLFDLPWYKVGLYGNRHAEEQDLAHDEKQREADEQRATGHHSEHLPADKPAAAATA
SYP*
Coding >Hirsu2|5307
CTGGACCGCGAGCTCGAGGCGACGCGCGGCGTCGGCCTGCTGGGCAAGGTCAAGGAGATGTTCATGGACCGGCGC
AACCTGTACCGGGTCTACCTGGTGACCATGGTGCAGCTGCTGTCGCAGTGGTCCGGGGCCGGCTCCATCACCGTC
TACGCGCCCGACCTGTTCCGCATCCTCGGCATCAGCGGCAGCGAGGAGGGCCTGCTGGTGACGGCCGTCTTCGGC
ATCGTCAAGCTGGTGGCGGCCCTGCTGTGCGCCCTCTTCCTCGTCGACGTCATCGGCCGCAAGCGCGCGCTGCTG
TCGGGCATCACGCTGCAGGCCGTCTCCATCATCTACGTGGCCGCCTTCCTGACGGCGGTGCCGCAGCTGGGCGTC
GACGACGACTTCGTCCTGCCCGAGGACCGCAAGCCGGCCAGCCGCGGCGCCATCGCCATGATCTACATCTCCGGC
TGCGGCTGGGCCCTCGGCTGGAACTCGATGCAGTACCTGCTGACGGCCGAGCTGTTCCCGCTGCGCATCCGCGCC
CTCGCCACCTCGTGGGCCATGACGCTGCACTTCGCCAACCAGTACGGCAACTCGCGCGCCGTGCCCAACATGCTG
CTGCCCGTCGACGAGGGCGGCATCTCGCCCAAGGGCACCTTCTGGTGCTTCGCCGCCGTCACCCTCCTCGGCGGC
CTCTGGGTCTGGCTGTCCGTCCCGGAGACGAGCGGCCGCAGCCTCGAGAACATGGACCGCCTCTTCGACCTGCCG
TGGTACAAGGTCGGCCTCTACGGCAACCGCCACGCCGAAGAGCAGGACCTGGCCCACGACGAGAAGCAGCGCGAG
GCCGACGAGCAGCGCGCCACCGGCCACCACTCCGAGCATCTGCCCGCCGACAAGCCGGCCGCCGCAGCCACGGCC
TCGTACCCCTGA
Transcript >Hirsu2|5307
CTGGACCGCGAGCTCGAGGCGACGCGCGGCGTCGGCCTGCTGGGCAAGGTCAAGGAGATGTTCATGGACCGGCGC
AACCTGTACCGGGTCTACCTGGTGACCATGGTGCAGCTGCTGTCGCAGTGGTCCGGGGCCGGCTCCATCACCGTC
TACGCGCCCGACCTGTTCCGCATCCTCGGCATCAGCGGCAGCGAGGAGGGCCTGCTGGTGACGGCCGTCTTCGGC
ATCGTCAAGCTGGTGGCGGCCCTGCTGTGCGCCCTCTTCCTCGTCGACGTCATCGGCCGCAAGCGCGCGCTGCTG
TCGGGCATCACGCTGCAGGCCGTCTCCATCATCTACGTGGCCGCCTTCCTGACGGCGGTGCCGCAGCTGGGCGTC
GACGACGACTTCGTCCTGCCCGAGGACCGCAAGCCGGCCAGCCGCGGCGCCATCGCCATGATCTACATCTCCGGC
TGCGGCTGGGCCCTCGGCTGGAACTCGATGCAGTACCTGCTGACGGCCGAGCTGTTCCCGCTGCGCATCCGCGCC
CTCGCCACCTCGTGGGCCATGACGCTGCACTTCGCCAACCAGTACGGCAACTCGCGCGCCGTGCCCAACATGCTG
CTGCCCGTCGACGAGGGCGGCATCTCGCCCAAGGGCACCTTCTGGTGCTTCGCCGCCGTCACCCTCCTCGGCGGC
CTCTGGGTCTGGCTGTCCGTCCCGGAGACGAGCGGCCGCAGCCTCGAGAACATGGACCGCCTCTTCGACCTGCCG
TGGTACAAGGTCGGCCTCTACGGCAACCGCCACGCCGAAGAGCAGGACCTGGCCCACGACGAGAAGCAGCGCGAG
GCCGACGAGCAGCGCGCCACCGGCCACCACTCCGAGCATCTGCCCGCCGACAAGCCGGCCGCCGCAGCCACGGCC
TCGTACCCCTGA
Gene >Hirsu2|5307
CTGGACCGCGAGCTCGAGGCGACGCGCGGCGTCGGCCTGCTGGGCAAGGTCAAGGAGATGTTCATGGACCGGCGC
AACCTGTACCGGGTCTACCTGGTGACCATGGTGCAGCTGCTGTCGCAGTGGTCCGGGGCCGGCTCCATCACCGTC
TACGCGCCCGACCTGTTCCGCATCCTCGGCATCAGCGGCAGCGAGGAGGGCCTGCTGGTGACGGCCGTCTTCGGC
ATCGTCAAGCTGGTGGCGGCCCTGCTGTGCGCCCTCTTCCTCGTCGACGTCATCGGCCGCAAGCGCGCGCTGCTG
TCGGGCATCACGCTGCAGGCCGTCTCCATCATCTACGTGGCCGCCTTCCTGACGGCGGTGCCGCAGCTGGGCGTC
GACGACGACTTCGTCCTGCCCGAGGACCGCAAGCCGGCCAGCCGCGGCGCCATCGCCATGATCTACATCTCCGGC
TGCGGCTGGGCCCTCGGCTGGAACTCGATGCAGTACCTGCTGACGGCCGAGCTGTTCCCGCTGCGCATCCGCGCC
CTCGCCACCTCGTGGGCCATGACGCTGCACTTCGCCAACCAGTACGGCAACTCGCGCGCCGTGCCCAACATGCTG
CTGCCCGTCGACGAGGGCGGCATCTCGCCCAAGGGCACCTTCTGGTGCTTCGCCGCCGTCACCCTCCTCGGCGGC
CTCTGGGTCTGGCTGTCCGTCCCGGAGACGAGCGGCCGCAGCCTCGAGAACATGGACCGCCTCTTCGACCTGCCG
TGGTACAAGGTCGGCCTCTACGGCAACCGCCACGCCGAAGAGCAGGACCTGGCCCACGACGAGAAGCAGCGCGAG
GCCGACGAGCAGCGCGCCACCGGCCACCACTCCGAGCATCTGCCCGCCGACAAGCCGGCCGCCGCAGCCACGGCC
TCGTACCCCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail