Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5303
Gene name
LocationContig_265:14276..17395
Strand+
Gene length (bp)3119
Transcript length (bp)2703
Coding sequence length (bp)2703
Protein length (aa) 901

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03707 MHYT Bacterial signalling protein N terminal repeat 6.9E-11 67 124

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O34311|YKOW_BACSU Signaling protein YkoW OS=Bacillus subtilis (strain 168) GN=ykoW PE=3 SV=2 19 218 8.0E-14
sp|Q9I310|Y1727_PSEAE Uncharacterized signaling protein PA1727 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA1727 PE=3 SV=1 19 258 7.0E-10

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22
2 55 77 22
3 97 119 22
4 124 146 22
5 161 183 22
6 236 258 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5303
MSSTQELLQEFSGELVPFSFHAGFVCLSYIISLIGTGSTLELMRRRTSHKGLHNLLLLIGAAASMGGIAIWSMHF
IGNRAIYILDGREDLQISYSTGMTVLSLLVPILVLLLAFLAVSVNDRIRWWRIGLAGLLSGGAICGMHYLADRSI
SNYQTSYERGYVVGAAMIAISASTTALTLFFVFETAWNIVWWKRFGCAMVLAGAVSGMHWCAAVGTSYRLLQITS
LHKGMSRHETLIMVICLSIAACIVMVISSFYSSWVKRDYASKSQQVVLAAAIFDEKGRIMVNQEGFLPSEVVTDT
FMTKSHDDVFDTAHHLFHWMYRASRNWISIAESTDKMARHIRYLSQNKHSGRTGLKLVREDGSLVRDYDQIVCEL
FCLAALALATKTKESLIHAGTLWDEIFATGNNPNRSNLTHTTEDANDASSERTRRHKKLAKDKSIFDGLAEKGLV
RAHPQDGRGCLMFLVRHANVRKDIHKLEAAGYRFAEIHHVVDSIRSSMQIRSPDFISRLRGMSNLCGKNIAPASG
VHLGMFAVRARLDHCGFDVLVRKDAKNLLPMAALPLQRLEPWQLKFIQHFWGLNPSAIMKRLDEDGNLSIQEARL
ASHLRAAILSLRRDLSAAHFDDATLVSQVVQAPCSVDGDNSSPLSTCSLAVFRIMLPIHINGDQLTDFEFVPLSF
FKVQQMVYAGSAHHVEFSHQVHRELSSMVHSFPELGLNGPQTRPSLRLPLHAWMARFRCSARTGNDVALQSSTRS
QERLSGASSSRSWPRPLSDEISLDDYYKSHSASMSSHVNVSSPLSSTSSAEDAPHRQRQQLFGGIMVSQQITVDV
QEIERSIPLSDQRRGKTQPNTKYYTSHDEKSNAVKQNNYFSTIASGKANAAITKEQGGSDFIDELLSFCMERRDT
*
Coding >Hirsu2|5303
ATGTCGTCGACCCAAGAACTGCTTCAAGAATTCTCGGGCGAGCTGGTCCCATTCTCTTTTCATGCCGGCTTTGTT
TGTTTGAGCTATATCATCAGCCTCATCGGAACTGGCTCGACGCTAGAGTTGATGCGGAGGAGGACGTCGCATAAG
GGGCTTCACAACCTCTTGCTGTTGATTGGTGCTGCCGCATCCATGGGAGGCATTGCCATCTGGTCTATGCATTTT
ATCGGCAACAGAGCGATATATATCCTCGACGGTCGCGAGGACCTTCAGATCTCGTACTCTACGGGCATGACGGTT
TTGTCACTGCTTGTCCCTATTCTCGTGCTGCTACTCGCTTTTCTCGCCGTGAGCGTCAACGATCGAATCCGCTGG
TGGCGTATAGGTCTGGCCGGCTTATTGTCCGGCGGTGCAATATGTGGAATGCATTACCTAGCGGATAGGTCGATC
AGCAACTACCAAACCTCCTACGAGCGTGGCTATGTGGTCGGCGCAGCCATGATTGCCATATCCGCGAGCACTACG
GCTCTGACCCTTTTCTTTGTTTTCGAAACGGCATGGAACATTGTCTGGTGGAAGCGGTTTGGGTGCGCCATGGTA
CTTGCCGGGGCCGTTTCTGGCATGCACTGGTGCGCAGCCGTTGGCACGAGCTATAGGCTTCTCCAGATCACTTCC
CTTCACAAAGGGATGTCCCGACACGAGACGTTAATCATGGTCATCTGCTTGTCTATTGCTGCATGCATCGTCATG
GTCATTAGCAGCTTCTATTCGAGCTGGGTAAAACGAGACTATGCCAGCAAATCGCAGCAGGTCGTTCTCGCTGCA
GCAATATTCGACGAGAAAGGTAGAATCATGGTCAACCAAGAAGGTTTTCTCCCGAGCGAAGTGGTCACCGACACG
TTCATGACCAAGTCACACGACGATGTTTTCGATACGGCCCATCATCTCTTCCACTGGATGTACCGGGCCTCGCGT
AATTGGATCAGCATCGCGGAGTCTACGGACAAAATGGCTCGTCATATACGATATCTTTCGCAAAACAAGCATAGC
GGCAGAACAGGGCTTAAGCTAGTCAGGGAGGATGGTTCATTGGTCCGTGATTACGATCAAATTGTCTGCGAGTTA
TTTTGTCTCGCGGCACTAGCCCTTGCAACAAAGACAAAAGAGTCTCTAATCCACGCCGGCACGCTTTGGGACGAG
ATATTCGCCACTGGCAACAATCCGAATCGTTCGAATCTGACTCACACGACAGAAGATGCCAACGACGCTAGCTCG
GAAAGGACTCGCCGGCACAAGAAGCTAGCGAAAGACAAATCCATTTTTGACGGTCTGGCCGAGAAAGGGCTGGTC
CGCGCTCACCCACAAGACGGCCGGGGCTGTCTCATGTTTCTTGTTCGTCACGCCAACGTCAGGAAGGATATCCAC
AAGCTCGAAGCCGCCGGTTACCGGTTTGCCGAGATACACCACGTCGTCGATAGCATCCGATCCAGTATGCAGATC
AGAAGCCCAGACTTCATATCCAGGCTGAGAGGGATGTCGAACCTTTGCGGTAAGAATATCGCTCCGGCCTCGGGG
GTTCATCTCGGCATGTTCGCCGTCCGGGCTAGACTTGACCACTGCGGTTTCGATGTGCTCGTGCGAAAAGATGCC
AAAAACCTTCTGCCTATGGCAGCGCTGCCGCTTCAACGTCTCGAGCCGTGGCAGTTGAAGTTTATTCAGCATTTT
TGGGGCCTGAATCCGTCGGCCATCATGAAGCGGCTCGATGAAGACGGAAACCTCTCCATACAGGAAGCCAGGTTG
GCGTCTCATTTGCGCGCTGCCATTCTCTCTCTCCGTCGAGATCTGAGTGCCGCCCACTTCGACGATGCCACTCTC
GTGTCTCAAGTCGTACAAGCTCCTTGTTCTGTCGACGGCGATAACAGCTCGCCGCTGTCGACGTGCTCGCTCGCT
GTGTTCCGAATAATGCTCCCGATTCACATAAACGGGGATCAACTAACTGACTTTGAGTTTGTGCCCCTGAGTTTC
TTCAAAGTGCAGCAAATGGTCTATGCAGGGTCAGCACACCATGTGGAGTTTTCCCATCAAGTACACCGTGAACTA
TCGTCCATGGTCCACAGCTTCCCCGAGCTAGGTCTCAATGGGCCCCAAACCCGGCCTTCTTTGCGTCTGCCATTA
CATGCTTGGATGGCCAGATTTCGATGCAGTGCCCGCACAGGCAACGATGTCGCCCTGCAGTCGTCGACCAGGAGT
CAGGAACGCTTATCAGGGGCTTCTTCGAGCCGAAGCTGGCCACGCCCCCTGAGTGATGAAATCAGCCTTGACGAC
TATTACAAAAGTCACTCTGCCAGCATGTCATCACATGTAAACGTTTCGTCGCCCCTGAGCTCCACGTCAAGTGCT
GAGGATGCTCCTCATCGCCAACGCCAGCAATTATTTGGCGGTATCATGGTCTCGCAACAGATTACAGTGGATGTC
CAAGAGATAGAGAGGAGCATCCCGCTCAGCGACCAGCGCAGAGGAAAGACACAGCCAAATACCAAATATTACACA
TCGCACGACGAGAAAAGCAATGCGGTTAAGCAAAATAACTATTTCTCTACCATTGCTTCCGGCAAAGCAAACGCG
GCGATAACTAAGGAGCAGGGCGGTTCCGATTTTATTGATGAGCTACTTTCATTCTGTATGGAAAGACGCGACACC
TGA
Transcript >Hirsu2|5303
ATGTCGTCGACCCAAGAACTGCTTCAAGAATTCTCGGGCGAGCTGGTCCCATTCTCTTTTCATGCCGGCTTTGTT
TGTTTGAGCTATATCATCAGCCTCATCGGAACTGGCTCGACGCTAGAGTTGATGCGGAGGAGGACGTCGCATAAG
GGGCTTCACAACCTCTTGCTGTTGATTGGTGCTGCCGCATCCATGGGAGGCATTGCCATCTGGTCTATGCATTTT
ATCGGCAACAGAGCGATATATATCCTCGACGGTCGCGAGGACCTTCAGATCTCGTACTCTACGGGCATGACGGTT
TTGTCACTGCTTGTCCCTATTCTCGTGCTGCTACTCGCTTTTCTCGCCGTGAGCGTCAACGATCGAATCCGCTGG
TGGCGTATAGGTCTGGCCGGCTTATTGTCCGGCGGTGCAATATGTGGAATGCATTACCTAGCGGATAGGTCGATC
AGCAACTACCAAACCTCCTACGAGCGTGGCTATGTGGTCGGCGCAGCCATGATTGCCATATCCGCGAGCACTACG
GCTCTGACCCTTTTCTTTGTTTTCGAAACGGCATGGAACATTGTCTGGTGGAAGCGGTTTGGGTGCGCCATGGTA
CTTGCCGGGGCCGTTTCTGGCATGCACTGGTGCGCAGCCGTTGGCACGAGCTATAGGCTTCTCCAGATCACTTCC
CTTCACAAAGGGATGTCCCGACACGAGACGTTAATCATGGTCATCTGCTTGTCTATTGCTGCATGCATCGTCATG
GTCATTAGCAGCTTCTATTCGAGCTGGGTAAAACGAGACTATGCCAGCAAATCGCAGCAGGTCGTTCTCGCTGCA
GCAATATTCGACGAGAAAGGTAGAATCATGGTCAACCAAGAAGGTTTTCTCCCGAGCGAAGTGGTCACCGACACG
TTCATGACCAAGTCACACGACGATGTTTTCGATACGGCCCATCATCTCTTCCACTGGATGTACCGGGCCTCGCGT
AATTGGATCAGCATCGCGGAGTCTACGGACAAAATGGCTCGTCATATACGATATCTTTCGCAAAACAAGCATAGC
GGCAGAACAGGGCTTAAGCTAGTCAGGGAGGATGGTTCATTGGTCCGTGATTACGATCAAATTGTCTGCGAGTTA
TTTTGTCTCGCGGCACTAGCCCTTGCAACAAAGACAAAAGAGTCTCTAATCCACGCCGGCACGCTTTGGGACGAG
ATATTCGCCACTGGCAACAATCCGAATCGTTCGAATCTGACTCACACGACAGAAGATGCCAACGACGCTAGCTCG
GAAAGGACTCGCCGGCACAAGAAGCTAGCGAAAGACAAATCCATTTTTGACGGTCTGGCCGAGAAAGGGCTGGTC
CGCGCTCACCCACAAGACGGCCGGGGCTGTCTCATGTTTCTTGTTCGTCACGCCAACGTCAGGAAGGATATCCAC
AAGCTCGAAGCCGCCGGTTACCGGTTTGCCGAGATACACCACGTCGTCGATAGCATCCGATCCAGTATGCAGATC
AGAAGCCCAGACTTCATATCCAGGCTGAGAGGGATGTCGAACCTTTGCGGTAAGAATATCGCTCCGGCCTCGGGG
GTTCATCTCGGCATGTTCGCCGTCCGGGCTAGACTTGACCACTGCGGTTTCGATGTGCTCGTGCGAAAAGATGCC
AAAAACCTTCTGCCTATGGCAGCGCTGCCGCTTCAACGTCTCGAGCCGTGGCAGTTGAAGTTTATTCAGCATTTT
TGGGGCCTGAATCCGTCGGCCATCATGAAGCGGCTCGATGAAGACGGAAACCTCTCCATACAGGAAGCCAGGTTG
GCGTCTCATTTGCGCGCTGCCATTCTCTCTCTCCGTCGAGATCTGAGTGCCGCCCACTTCGACGATGCCACTCTC
GTGTCTCAAGTCGTACAAGCTCCTTGTTCTGTCGACGGCGATAACAGCTCGCCGCTGTCGACGTGCTCGCTCGCT
GTGTTCCGAATAATGCTCCCGATTCACATAAACGGGGATCAACTAACTGACTTTGAGTTTGTGCCCCTGAGTTTC
TTCAAAGTGCAGCAAATGGTCTATGCAGGGTCAGCACACCATGTGGAGTTTTCCCATCAAGTACACCGTGAACTA
TCGTCCATGGTCCACAGCTTCCCCGAGCTAGGTCTCAATGGGCCCCAAACCCGGCCTTCTTTGCGTCTGCCATTA
CATGCTTGGATGGCCAGATTTCGATGCAGTGCCCGCACAGGCAACGATGTCGCCCTGCAGTCGTCGACCAGGAGT
CAGGAACGCTTATCAGGGGCTTCTTCGAGCCGAAGCTGGCCACGCCCCCTGAGTGATGAAATCAGCCTTGACGAC
TATTACAAAAGTCACTCTGCCAGCATGTCATCACATGTAAACGTTTCGTCGCCCCTGAGCTCCACGTCAAGTGCT
GAGGATGCTCCTCATCGCCAACGCCAGCAATTATTTGGCGGTATCATGGTCTCGCAACAGATTACAGTGGATGTC
CAAGAGATAGAGAGGAGCATCCCGCTCAGCGACCAGCGCAGAGGAAAGACACAGCCAAATACCAAATATTACACA
TCGCACGACGAGAAAAGCAATGCGGTTAAGCAAAATAACTATTTCTCTACCATTGCTTCCGGCAAAGCAAACGCG
GCGATAACTAAGGAGCAGGGCGGTTCCGATTTTATTGATGAGCTACTTTCATTCTGTATGGAAAGACGCGACACC
TGA
Gene >Hirsu2|5303
ATGTCGTCGACCCAAGAACTGCTTCAAGAATTCTCGGGCGAGCTGGTCCCATTCTCTTTTCATGCCGGCTTTGTT
TGTTTGAGCTATATCATCAGCCTCATCGGAACTGGCTCGACGCTAGAGTTGATGCGGAGGAGGACGTCGCATAAG
GGGCTTCACAACCTGTGAGCACCAAGGGGGCAGCAGCATGACGCAGATTGAGTAGATTTTCAGAATTCCGCTAAC
TTATGTGGCATAATAGCTTGCTGTTGATTGGTGCTGCCGCATCCATGGGAGGCATTGCCATCTGGTCTATGGTGT
GTACAACCCCTTGACGAGAAGTTGTGCTTTCCTCAATTCCTTCTTCATTTCGTTCCCGCACTCATACACGCTTTA
TGTTTGTGCGAAGCTCTCCACTAATCGTACGGCTCGCCATTGGCAGCATTTTATCGGCAACAGAGCGATATATAT
CCTCGACGGTCGCGAGGACCTTCAGATCTCGTACTCTACGGGCATGACGGTTTTGTCACTGCTTGTCCCTATTCT
CGTGCTGCTACTCGCTTTTCTCGCCGTGAGCGTCAACGATCGAATCCGCTGGTGGCGTATAGGTCTGGCCGGCTT
ATTGTCCGGCGGTGCAATATGTGGAATGCATTACCTAGCGGATAGGTCGATCAGCAACTACCAAACCTCCTACGA
GCGTGGCTATGTGGTCGGCGCAGCCATGATTGCCATATCCGCGAGCACTACGGCTCTGACCCTTTTCTTTGTTTT
CGAAACGGCATGGAACATTGTCTGGTGGAAGCGGTTTGGGTGCGCCATGGTACTTGCCGGGGCCGTTTCTGGCAT
GCACTGGTGCGCAGCCGTTGGCACGAGCTATAGGCTTCTCCAGATCACTTCCCTTCACAAAGGGATGTCCCGACA
CGAGACGTTAATCATGGTCATCTGCTTGGTAAGTCTTACTCCCGTATTCAATTCGCAACCAAACTTCCCTCCAAA
CACCGTGCCAAGGGCGCCTGCCAACGTCGAGTAACGTCAACAGTCTATTGCTGCATGCATCGTCATGGTCATTAG
CAGCTTCTATTCGAGCTGGGTAAAACGAGACTATGCCAGCAAATCGCAGCAGGTCGTTCTCGCTGCAGCAATATT
CGACGAGAAAGGTAGAATCATGGTCAACCAAGAAGGTTTTCTCCCGAGCGAAGTGGTCACCGACACGTTCATGAC
CAAGGTTCGAAAACCCCTAAATTGCACAGCCGCATAGCATCTAACATACTATATAACAAGTCACACGACGATGTT
TTCGATACGGCCCATCATCTCTTCCACTGGATGTACCGGGCCTCGCGTAATTGGATCAGCATCGCGGAGTCTACG
GACAAAATGGCTCGTCATATACGATATCTTTCGCAAAACAAGCATAGCGGCAGAACAGGGCTTAAGCTAGTCAGG
GAGGATGGTTCATTGGTCCGTGATTACGATCAAATTGTCTGCGAGTTATTTTGTCTCGCGGCACTAGCCCTTGCA
ACAAAGACAAAAGAGTCTCTAATCCACGCCGGCACGCTTTGGGACGAGATATTCGCCACTGGCAACAATCCGAAT
CGTTCGAATCTGACTCACACGACAGAAGATGCCAACGACGCTAGCTCGGAAAGGACTCGCCGGCACAAGAAGCTA
GCGAAAGACAAATCCATTTTTGACGGTCTGGCCGAGAAAGGGCTGGTCCGCGCTCACCCACAAGACGGCCGGGGC
TGTCTCATGTTTCTTGTTCGTCACGCCAACGTCAGGAAGGATATCCACAAGCTCGAAGCCGCCGGTTACCGGTTT
GCCGAGATACACCACGTCGTCGATAGCATCCGATCCAGTATGCAGATCAGAAGCCCAGACTTCATATCCAGGCTG
AGAGGGATGTCGAACCTTTGCGGTAAGAATATCGCTCCGGCCTCGGGGGTTCATCTCGGCATGTTCGCCGTCCGG
GCTAGACTTGACCACTGCGGTTTCGATGTGCTCGTGCGAAAAGATGCCAAAAACCTTCTGCCTATGGCAGCGCTG
CCGCTTCAACGTCTCGAGCCGTGGCAGTTGAAGTTTATTCAGCATTTTTGGGGCCTGAATCCGTCGGCCATCATG
AAGCGGCTCGATGAAGACGGAAACCTCTCCATACAGGAAGCCAGGTTGGCGTCTCATTTGCGCGCTGCCATTCTC
TCTCTCCGTCGAGATCTGAGTGCCGCCCACTTCGACGATGCCACTCTCGTGTCTCAAGTCGTACAAGCTCCTTGT
TCTGTCGACGGCGATAACAGCTCGCCGCTGTCGACGTGCTCGCTCGCTGTGTTCCGAATAATGCTCCCGATTCAC
ATAAACGGGGATCAACTAACTGACTTTGAGTTTGTGCCCCTGAGTTTCTTCAAAGTGCAGCAAATGGTCTATGCA
GGGTCAGCACACCATGTGGAGTTTTCCCATCAAGTACACCGTGAACTATCGTCCATGGTCCACAGCTTCCCCGAG
CTAGGTCTCAATGGGCCCCAAACCCGGCCTTCTTTGCGTCTGCCATTACATGCTTGGATGGCCAGATTTCGATGC
AGTGCCCGCACAGGCAACGATGTCGCCCTGCAGTCGTCGACCAGGAGTCAGGAACGCTTATCAGGGGCTTCTTCG
AGCCGAAGCTGGCCACGCCCCCTGAGTGATGAAATCAGCCTTGACGACTATTACAAAAGTCACTCTGCCAGCATG
TCATCACATGTAAACGTTTCGTCGCCCCTGAGCTCCACGTCAAGTGCTGAGGATGCTCCTCATCGCCAACGCCAG
CAATTATTTGGCGGTATCATGGTCTCGCAACAGATTACAGTGGATGTCCAAGAGGTAAGTATGAACAAGACAGCT
CGAGTCATAAAAGCTACTGTTAACGAAAAGGGGTGCGGACGTCACAGATAGAGAGGAGCATCCCGCTCAGCGACC
AGCGCAGAGGAAAGACACAGCCAAATACCAAATATTACACATCGCACGACGAGAAAAGCAATGCGGTTAAGCAAA
ATAACTATTTCTCTACCATTGCTTCCGGCAAAGCAAACGCGGCGATAACTAAGGAGCAGGGCGGTTCCGATTTTA
TTGATGAGCTACTTTCATTCTGTATGGAAAGACGCGACACCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail