Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5301
Gene name
LocationContig_265:904..6687
Strand-
Gene length (bp)5783
Transcript length (bp)5598
Coding sequence length (bp)5598
Protein length (aa) 1866

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08659 KR KR domain 1.3E-65 1495 1673
PF00698 Acyl_transf_1 Acyl transferase domain 1.1E-56 165 493
PF14765 PS-DH Polyketide synthase dehydratase 8.0E-39 545 862
PF00106 adh_short short chain dehydrogenase 6.9E-21 1497 1656
PF16197 KAsynt_C_assoc Ketoacyl-synthetase C-terminal extension 3.6E-18 17 136
PF00107 ADH_zinc_N Zinc-binding dehydrogenase 2.3E-16 1297 1395
PF13602 ADH_zinc_N_2 Zinc-binding dehydrogenase 4.7E-13 1346 1472
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 6.4E-14 1504 1654
PF00550 PP-binding Phosphopantetheine attachment site 3.1E-08 1792 1852
PF08240 ADH_N Alcohol dehydrogenase GroES-like domain 4.6E-08 1180 1250
PF02719 Polysacc_synt_2 Polysaccharide biosynthesis protein 1.8E-05 1498 1630

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 1001 1857 6.0E-151
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 2 876 2.0E-114
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 1154 1849 5.0E-89
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 1154 1849 5.0E-89
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 1176 1849 1.0E-80
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 1001 1857 6.0E-151
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 2 876 2.0E-114
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 1154 1849 5.0E-89
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 1154 1849 5.0E-89
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 1176 1849 1.0E-80
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 1176 1849 1.0E-80
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 1176 1849 1.0E-80
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 1176 1849 1.0E-80
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 1176 1849 1.0E-80
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 1049 1849 1.0E-80
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 2 655 1.0E-79
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 2 655 2.0E-78
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 1156 1824 3.0E-77
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 1156 1824 5.0E-77
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 7 805 2.0E-74
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 1082 1667 1.0E-73
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 2 803 4.0E-73
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 1156 1824 4.0E-73
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 1161 1849 7.0E-71
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 1057 1836 1.0E-69
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 1191 1695 1.0E-66
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 1254 1839 5.0E-66
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 1003 1680 7.0E-65
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 1191 1689 1.0E-64
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 1181 1697 3.0E-64
sp|Q869W9|PKS16_DICDI Probable polyketide synthase 16 OS=Dictyostelium discoideum GN=pks16 PE=2 SV=1 1005 1836 5.0E-60
sp|Q869X2|PKS17_DICDI Probable polyketide synthase 17 OS=Dictyostelium discoideum GN=pks17 PE=3 SV=1 1182 1836 1.0E-59
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 1 782 4.0E-58
sp|Q869W9|PKS16_DICDI Probable polyketide synthase 16 OS=Dictyostelium discoideum GN=pks16 PE=2 SV=1 7 780 8.0E-55
sp|Q869X2|PKS17_DICDI Probable polyketide synthase 17 OS=Dictyostelium discoideum GN=pks17 PE=3 SV=1 7 780 1.0E-53
sp|Q54QD3|PKS22_DICDI Probable polyketide synthase 22 OS=Dictyostelium discoideum GN=pks22 PE=3 SV=1 1167 1855 4.0E-53
sp|Q55DM7|PKS2_DICDI Probable polyketide synthase 2 OS=Dictyostelium discoideum GN=pks2 PE=3 SV=1 1182 1854 8.0E-53
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 1177 1846 1.0E-52
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 1181 1845 5.0E-52
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 1177 1846 2.0E-51
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 1177 1846 3.0E-51
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 1177 1853 1.0E-50
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 1177 1861 1.0E-50
sp|Q54QD1|PKS23_DICDI Probable polyketide synthase 23 OS=Dictyostelium discoideum GN=pks23 PE=3 SV=1 1167 1855 1.0E-49
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 16 728 2.0E-49
sp|Q54KU3|PKS25_DICDI Probable polyketide synthase 25 OS=Dictyostelium discoideum GN=pks25 PE=3 SV=1 1170 1845 3.0E-49
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 1177 1852 4.0E-49
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 1177 1846 5.0E-49
sp|Q54QD3|PKS22_DICDI Probable polyketide synthase 22 OS=Dictyostelium discoideum GN=pks22 PE=3 SV=1 1 643 2.0E-48
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 2 626 3.0E-48
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 2 626 3.0E-48
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 2 626 3.0E-48
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 2 626 3.0E-48
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 1177 1846 3.0E-48
sp|Q54QD1|PKS23_DICDI Probable polyketide synthase 23 OS=Dictyostelium discoideum GN=pks23 PE=3 SV=1 1 594 2.0E-47
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 2 626 3.0E-47
sp|B0G100|PKS7_DICDI Probable polyketide synthase 7 OS=Dictyostelium discoideum GN=pks7 PE=3 SV=1 1 782 6.0E-47
sp|Q54KU5|PKS24_DICDI Probable polyketide synthase 24 OS=Dictyostelium discoideum GN=pks24 PE=3 SV=1 1181 1845 8.0E-47
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 2 653 1.0E-46
sp|Q54KU3|PKS25_DICDI Probable polyketide synthase 25 OS=Dictyostelium discoideum GN=pks25 PE=3 SV=1 1 781 1.0E-46
sp|Q54ED7|PKS40_DICDI Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 1177 1852 2.0E-46
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 1177 1857 2.0E-46
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 1177 1833 9.0E-46
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 1177 1833 1.0E-45
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 1177 1857 1.0E-45
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 1177 1845 2.0E-45
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 1 781 6.0E-45
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 1177 1848 6.0E-45
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 1177 1848 6.0E-45
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 1 651 7.0E-45
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 1 782 7.0E-45
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 2 534 8.0E-45
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 1177 1833 1.0E-44
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 1181 1862 2.0E-44
sp|Q54KU5|PKS24_DICDI Probable polyketide synthase 24 OS=Dictyostelium discoideum GN=pks24 PE=3 SV=1 1 780 5.0E-44
sp|B0G103|PKS10_DICDI Probable polyketide synthase 10 OS=Dictyostelium discoideum GN=pks10 PE=3 SV=1 7 781 6.0E-44
sp|Q86JI5|PKS5_DICDI Probable polyketide synthase 5 OS=Dictyostelium discoideum GN=pks5 PE=2 SV=1 1 782 6.0E-44
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 1 628 4.0E-43
sp|Q54ED7|PKS40_DICDI Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 1 628 7.0E-43
sp|Q86JI5|PKS5_DICDI Probable polyketide synthase 5 OS=Dictyostelium discoideum GN=pks5 PE=2 SV=1 1177 1857 7.0E-43
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 1 782 9.0E-43
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 1 771 1.0E-42
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 1 772 3.0E-42
sp|B4XYB8|AZIB_STREG 5-methyl-1-naphthoate synthase OS=Streptomyces sahachiroi GN=aziB PE=1 SV=1 8 651 3.0E-42
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 1177 1853 5.0E-42
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 1489 1858 8.0E-42
sp|B0G100|PKS7_DICDI Probable polyketide synthase 7 OS=Dictyostelium discoideum GN=pks7 PE=3 SV=1 1177 1853 1.0E-41
sp|Q54IX3|PKS26_DICDI Probable polyketide synthase 26 OS=Dictyostelium discoideum GN=pks26 PE=3 SV=1 1177 1847 1.0E-41
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 2 604 2.0E-41
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 1 769 4.0E-41
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 17 448 5.0E-41
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 1177 1853 9.0E-41
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 1130 1854 2.0E-40
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 2 728 1.0E-39
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 2 457 2.0E-39
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 1 597 2.0E-39
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 1177 1853 2.0E-39
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 1 528 3.0E-39
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 2 623 4.0E-39
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 1177 1845 6.0E-39
sp|Q54IX3|PKS26_DICDI Probable polyketide synthase 26 OS=Dictyostelium discoideum GN=pks26 PE=3 SV=1 1 628 9.0E-39
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 1 713 2.0E-38
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 1 660 2.0E-38
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 2 806 2.0E-38
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 2 806 2.0E-38
sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 2 806 2.0E-38
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 2 728 3.0E-38
sp|Q55DM7|PKS2_DICDI Probable polyketide synthase 2 OS=Dictyostelium discoideum GN=pks2 PE=3 SV=1 1 680 4.0E-38
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 2 457 6.0E-38
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 2 528 1.0E-37
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 17 728 5.0E-37
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 1 662 1.0E-36
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 1177 1853 1.0E-36
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 36 532 2.0E-36
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 1 590 5.0E-36
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 1 662 6.0E-36
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 1 779 2.0E-35
sp|Q03149|WA_EMENI Conidial yellow pigment biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=wA PE=1 SV=2 1 476 2.0E-35
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 1431 1849 3.0E-35
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 1 719 5.0E-35
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 1431 1849 6.0E-35
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 144 781 8.0E-35
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 2 528 8.0E-34
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 1 659 9.0E-34
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 83 728 4.0E-33
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 1514 1848 7.0E-33
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 45 531 5.0E-32
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 1 659 8.0E-32
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 7 594 2.0E-31
sp|Q12053|PKSL1_ASPPA Noranthrone synthase OS=Aspergillus parasiticus GN=pksL1 PE=1 SV=1 1 528 2.0E-31
sp|Q7TXM0|PPSA_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsA PE=1 SV=1 2 621 3.0E-31
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 160 662 4.0E-31
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 160 662 5.0E-31
sp|P22367|MSAS_PENPA 6-methylsalicylic acid synthase OS=Penicillium patulum PE=1 SV=1 2 591 1.0E-30
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 2 534 2.0E-30
sp|P9WQE6|PPSA_MYCTO Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsA PE=3 SV=1 2 621 2.0E-30
sp|P9WQE7|PPSA_MYCTU Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsA PE=1 SV=1 2 621 2.0E-30
sp|Q12397|STCA_EMENI Putative sterigmatocystin biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcA PE=3 SV=2 1 527 6.0E-30
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 1 455 1.0E-29
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 1 455 2.0E-29
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 1405 1824 1.0E-28
sp|Q7TXL6|PPSE_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsE PE=1 SV=1 10 534 3.0E-27
sp|P9WQE1|PPSE_MYCTU Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsE PE=1 SV=1 10 534 3.0E-27
sp|P9WQE0|PPSE_MYCTO Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsE PE=3 SV=1 10 534 3.0E-27
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 2 775 3.0E-25
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 2 775 3.0E-25
sp|O97764|QOR_BOVIN Zeta-crystallin OS=Bos taurus GN=CRYZ PE=2 SV=2 1162 1389 3.0E-25
sp|Q7TXL9|PPSB_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsB PE=1 SV=1 2 528 8.0E-25
sp|P9WQE5|PPSB_MYCTU Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsB PE=1 SV=1 2 528 8.0E-25
sp|P9WQE4|PPSB_MYCTO Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsB PE=3 SV=1 2 528 8.0E-25
sp|Q8JFV8|VAT1_DANRE Synaptic vesicle membrane protein VAT-1 homolog OS=Danio rerio GN=vat1 PE=2 SV=1 1177 1472 9.0E-25
sp|P22367|MSAS_PENPA 6-methylsalicylic acid synthase OS=Penicillium patulum PE=1 SV=1 1490 1823 1.0E-24
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 1492 1657 3.0E-24
sp|Q5R4S7|QOR_PONAB Quinone oxidoreductase OS=Pongo abelii GN=CRYZ PE=2 SV=1 1162 1389 5.0E-24
sp|Q08257|QOR_HUMAN Quinone oxidoreductase OS=Homo sapiens GN=CRYZ PE=1 SV=1 1162 1389 5.0E-24
sp|B4XYB8|AZIB_STREG 5-methyl-1-naphthoate synthase OS=Streptomyces sahachiroi GN=aziB PE=1 SV=1 1415 1661 7.0E-24
sp|A7RK30|QORL2_NEMVE Quinone oxidoreductase-like protein 2 homolog OS=Nematostella vectensis GN=v1g238856 PE=3 SV=1 1177 1472 7.0E-24
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 125 555 1.0E-23
sp|Q0MVN8|QOR_PIG Quinone oxidoreductase OS=Sus scrofa GN=CRYZ PE=2 SV=1 1179 1389 1.0E-23
sp|P28304|QOR1_ECOLI Quinone oxidoreductase 1 OS=Escherichia coli (strain K12) GN=qorA PE=1 SV=1 1179 1400 2.0E-23
sp|Q80TB8|VAT1L_MOUSE Synaptic vesicle membrane protein VAT-1 homolog-like OS=Mus musculus GN=Vat1l PE=1 SV=2 1145 1472 2.0E-23
sp|P40783|QOR_SALTY Quinone oxidoreductase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=qor PE=3 SV=2 1179 1400 3.0E-23
sp|Q9HCJ6|VAT1L_HUMAN Synaptic vesicle membrane protein VAT-1 homolog-like OS=Homo sapiens GN=VAT1L PE=1 SV=2 1150 1472 3.0E-23
sp|P19333|VAT1_TORCA Synaptic vesicle membrane protein VAT-1 OS=Torpedo californica PE=1 SV=1 1177 1387 2.0E-22
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 1490 1855 4.0E-22
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 1490 1855 4.0E-22
sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 1490 1855 4.0E-22
sp|P47199|QOR_MOUSE Quinone oxidoreductase OS=Mus musculus GN=Cryz PE=1 SV=1 1162 1389 2.0E-21
sp|Q59I44|CAA43_BURSP 2-haloacrylate reductase OS=Burkholderia sp. GN=caa43 PE=1 SV=1 1158 1377 4.0E-21
sp|P11415|QOR_CAVPO Quinone oxidoreductase OS=Cavia porcellus GN=CRYZ PE=1 SV=1 1179 1389 9.0E-21
sp|O34877|PKSD_BACSU Polyketide biosynthesis acyltransferase homolog PksD OS=Bacillus subtilis (strain 168) GN=pksD PE=1 SV=2 163 456 2.0E-20
sp|Q6AYT0|QOR_RAT Quinone oxidoreductase OS=Rattus norvegicus GN=Cryz PE=2 SV=1 1162 1389 2.0E-20
sp|Q7TXL9|PPSB_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsB PE=1 SV=1 1491 1668 3.0E-20
sp|P9WQE5|PPSB_MYCTU Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsB PE=1 SV=1 1491 1668 3.0E-20
sp|P9WQE4|PPSB_MYCTO Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsB PE=3 SV=1 1491 1668 3.0E-20
sp|A7Z4X9|BAED_BACMF Polyketide biosynthesis acyltransferase homolog BaeD OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeD PE=1 SV=1 163 456 3.0E-20
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 1455 1657 4.0E-20
sp|Q28452|QOR_LAMGU Quinone oxidoreductase OS=Lama guanicoe GN=CRYZ PE=2 SV=1 1162 1389 4.0E-20
sp|P43903|QOR_PSEAE Quinone oxidoreductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=qor PE=3 SV=2 1156 1474 6.0E-20
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 1510 1849 1.0E-19
sp|P71019|FABD_BACSU Malonyl CoA-acyl carrier protein transacylase OS=Bacillus subtilis (strain 168) GN=fabD PE=3 SV=2 162 459 1.0E-19
sp|Q53FA7|QORX_HUMAN Quinone oxidoreductase PIG3 OS=Homo sapiens GN=TP53I3 PE=1 SV=2 1162 1472 6.0E-19
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 1479 1657 1.0E-18
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 1465 1667 2.0E-18
sp|Q7TXM0|PPSA_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsA PE=1 SV=1 1415 1855 2.0E-18
sp|P9WQE6|PPSA_MYCTO Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsA PE=3 SV=1 1415 1855 2.0E-18
sp|P9WQE7|PPSA_MYCTU Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsA PE=1 SV=1 1415 1855 2.0E-18
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 1489 1716 1.0E-17
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 1511 1827 2.0E-17
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 1478 1852 2.0E-17
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 1511 1667 3.0E-17
sp|Q99536|VAT1_HUMAN Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens GN=VAT1 PE=1 SV=2 1181 1474 5.0E-17
sp|A6QQF5|QORL2_BOVIN Quinone oxidoreductase-like protein 2 OS=Bos taurus PE=2 SV=2 1176 1473 7.0E-17
sp|B0BNC9|QORL2_RAT Quinone oxidoreductase-like protein 2 OS=Rattus norvegicus PE=2 SV=1 1176 1473 8.0E-17
sp|Q93QD4|FABD_STAAU Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus GN=fabD PE=3 SV=1 162 459 3.0E-16
sp|Q5HGK3|FABD_STAAC Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain COL) GN=fabD PE=3 SV=1 162 459 3.0E-16
sp|Q6GHK5|FABD_STAAR Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MRSA252) GN=fabD PE=3 SV=1 162 459 3.0E-16
sp|Q3UNZ8|QORL2_MOUSE Quinone oxidoreductase-like protein 2 OS=Mus musculus PE=1 SV=1 1176 1473 3.0E-16
sp|Q7A124|FABD_STAAW Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MW2) GN=fabD PE=3 SV=1 162 459 6.0E-16
sp|Q7A5Z3|FABD_STAAN Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain N315) GN=fabD PE=1 SV=1 162 459 6.0E-16
sp|Q99UN8|FABD_STAAM Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabD PE=1 SV=1 162 459 6.0E-16
sp|Q6G9Y3|FABD_STAAS Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MSSA476) GN=fabD PE=3 SV=1 162 459 6.0E-16
sp|A7Z4Y0|BAEE_BACMF Polyketide biosynthesis protein BaeE OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeE PE=1 SV=1 163 458 4.0E-15
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 1489 1657 6.0E-15
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 1496 1849 1.0E-14
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 1478 1689 2.0E-14
sp|Q3MIE4|VAT1_RAT Synaptic vesicle membrane protein VAT-1 homolog OS=Rattus norvegicus GN=Vat1 PE=1 SV=1 1181 1474 2.0E-14
sp|Q8H0M1|QORH_SPIOL Quinone-oxidoreductase homolog, chloroplastic OS=Spinacia oleracea GN=QOR PE=1 SV=1 1159 1474 2.0E-14
sp|O34825|PKSC_BACSU Polyketide biosynthesis malonyl CoA-acyl carrier protein transacylase PksC OS=Bacillus subtilis (strain 168) GN=pksC PE=1 SV=1 163 376 3.0E-13
sp|Q975C8|ACAR_SULTO Acryloyl-coenzyme A reductase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=STK_04800 PE=1 SV=1 1178 1474 4.0E-13
sp|P38230|QOR_YEAST Probable quinone oxidoreductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZTA1 PE=1 SV=1 1156 1472 4.0E-13
sp|A7Z4X8|BAEC_BACMF Polyketide biosynthesis malonyl CoA-acyl carrier protein transacylase BaeC OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeC PE=1 SV=1 163 389 4.0E-13
sp|A4YGN2|ACAR_METS5 Acryloyl-coenzyme A reductase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=Msed_1426 PE=1 SV=1 1181 1400 1.0E-12
sp|Q62465|VAT1_MOUSE Synaptic vesicle membrane protein VAT-1 homolog OS=Mus musculus GN=Vat1 PE=1 SV=3 1181 1474 2.0E-12
sp|O34787|PKSE_BACSU Polyketide biosynthesis protein PksE OS=Bacillus subtilis (strain 168) GN=pksE PE=1 SV=3 163 378 4.0E-12
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 1475 1667 5.0E-12
sp|Q9R9J2|FENF_BACIU Malonyl CoA-acyl carrier protein transacylase OS=Bacillus subtilis GN=fenF PE=1 SV=1 163 465 1.0E-11
sp|O74489|QOR_SCHPO Probable quinone oxidoreductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zta1 PE=1 SV=2 1184 1387 2.0E-11
sp|Q8BGC4|ZADH2_MOUSE Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Mus musculus GN=Zadh2 PE=1 SV=1 1170 1472 6.0E-11
sp|Q6P0H7|CBR4_DANRE Carbonyl reductase family member 4 OS=Danio rerio GN=cbr4 PE=2 SV=1 1498 1655 2.0E-10
sp|Q8N4Q0|ZADH2_HUMAN Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Homo sapiens GN=ZADH2 PE=1 SV=1 1170 1387 2.0E-10
sp|Q24K16|ZADH2_BOVIN Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Bos taurus GN=ZADH2 PE=2 SV=1 1170 1387 2.0E-10
sp|P0A2C9|FABG_SALTY 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fabG PE=1 SV=1 1498 1653 2.0E-10
sp|P0A2D0|FABG_SALTI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Salmonella typhi GN=fabG PE=3 SV=1 1498 1653 2.0E-10
sp|Q02207|FOX2_YEAST Peroxisomal hydratase-dehydrogenase-epimerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FOX2 PE=2 SV=1 1498 1661 3.0E-10
sp|P73574|FABG1_SYNY3 3-oxoacyl-[acyl-carrier-protein] reductase 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabG1 PE=1 SV=1 1498 1704 3.0E-10
sp|Q3SZJ4|PTGR1_BOVIN Prostaglandin reductase 1 OS=Bos taurus GN=PTGR1 PE=2 SV=1 1255 1472 5.0E-10
sp|P73242|FABD_SYNY3 Malonyl CoA-acyl carrier protein transacylase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabD PE=1 SV=1 162 369 5.0E-10
sp|Q9ZUC1|QORL_ARATH Quinone oxidoreductase-like protein At1g23740, chloroplastic OS=Arabidopsis thaliana GN=At1g23740 PE=2 SV=2 1162 1326 5.0E-10
sp|P96825|Y0148_MYCTU Putative short-chain type dehydrogenase/reductase Rv0148 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0148 PE=1 SV=3 1498 1661 5.0E-10
sp|O94564|YGD6_SCHPO Zinc-type alcohol dehydrogenase-like protein C1773.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.06c PE=3 SV=1 1177 1387 9.0E-10
sp|Q3IZ91|CCR_RHOS4 Crotonyl-CoA reductase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=ccr PE=3 SV=1 1181 1362 1.0E-09
sp|P66782|Y1385_MYCBO Uncharacterized oxidoreductase Mb1385 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fabG2 PE=3 SV=1 1496 1647 1.0E-09
sp|P9WGR9|Y1350_MYCTU Uncharacterized oxidoreductase Rv1350 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fabG2 PE=1 SV=1 1496 1647 1.0E-09
sp|P9WGR8|Y1350_MYCTO Uncharacterized oxidoreductase MT1393 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fabG2 PE=3 SV=1 1496 1647 1.0E-09
sp|P97584|PTGR1_RAT Prostaglandin reductase 1 OS=Rattus norvegicus GN=Ptgr1 PE=2 SV=3 1255 1472 2.0E-09
sp|Q84V25|ENOXE_FRAAN 2-methylene-furan-3-one reductase OS=Fragaria ananassa GN=EO PE=1 SV=1 1165 1474 2.0E-09
sp|P43712|FABD_HAEIN Malonyl CoA-acyl carrier protein transacylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fabD PE=3 SV=1 162 459 3.0E-09
sp|P51831|FABG_BACSU 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Bacillus subtilis (strain 168) GN=fabG PE=3 SV=3 1493 1646 3.0E-09
sp|A4IFA7|CBR4_BOVIN Carbonyl reductase family member 4 OS=Bos taurus GN=CBR4 PE=2 SV=1 1499 1653 5.0E-09
sp|P0AEK3|FABG_SHIFL 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Shigella flexneri GN=fabG PE=3 SV=1 1498 1653 5.0E-09
sp|P0AEK2|FABG_ECOLI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Escherichia coli (strain K12) GN=fabG PE=1 SV=1 1498 1653 5.0E-09
sp|P42865|QOR_LEIAM Probable quinone oxidoreductase OS=Leishmania amazonensis PE=3 SV=1 1209 1472 5.0E-09
sp|Q7TS56|CBR4_RAT Carbonyl reductase family member 4 OS=Rattus norvegicus GN=Cbr4 PE=2 SV=1 1499 1653 6.0E-09
sp|Q91YR9|PTGR1_MOUSE Prostaglandin reductase 1 OS=Mus musculus GN=Ptgr1 PE=1 SV=2 1255 1472 6.0E-09
sp|P34055|INC11_HYPAT Protein indc11 OS=Hypocrea atroviridis GN=indc11 PE=2 SV=1 1166 1377 9.0E-09
sp|Q39173|P2_ARATH NADP-dependent alkenal double bond reductase P2 OS=Arabidopsis thaliana GN=P2 PE=2 SV=2 1272 1472 9.0E-09
sp|Q4J781|ADH_SULAC NAD-dependent alcohol dehydrogenase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=adh PE=3 SV=1 1165 1472 1.0E-08
sp|Q59A28|QORL1_BOVIN Quinone oxidoreductase-like protein 1 OS=Bos taurus GN=CRYZL1 PE=2 SV=1 1208 1364 1.0E-08
sp|Q39172|P1_ARATH NADP-dependent alkenal double bond reductase P1 OS=Arabidopsis thaliana GN=P1 PE=1 SV=1 1272 1472 1.0E-08
sp|Q941I0|ENOXC_FRAAN 2-methylene-furan-3-one reductase OS=Fragaria ananassa GN=EO PE=1 SV=2 1165 1354 1.0E-08
sp|Q9BV79|MECR_HUMAN Trans-2-enoyl-CoA reductase, mitochondrial OS=Homo sapiens GN=MECR PE=1 SV=2 1182 1366 1.0E-08
sp|Q6WAU0|PULR_MENPI (+)-pulegone reductase OS=Mentha piperita PE=1 SV=1 1272 1473 2.0E-08
sp|Q9Z311|MECR_RAT Trans-2-enoyl-CoA reductase, mitochondrial OS=Rattus norvegicus GN=Mecr PE=1 SV=1 1182 1317 2.0E-08
sp|Q91VT4|CBR4_MOUSE Carbonyl reductase family member 4 OS=Mus musculus GN=Cbr4 PE=1 SV=2 1499 1653 2.0E-08
sp|O94038|ADH2_CANAL Alcohol dehydrogenase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ADH2 PE=3 SV=1 1238 1472 3.0E-08
sp|K4BW79|ENOX_SOLLC 2-methylene-furan-3-one reductase OS=Solanum lycopersicum GN=EO PE=1 SV=1 1162 1474 4.0E-08
sp|Q9EQZ5|PTGR1_CAVPO Prostaglandin reductase 1 OS=Cavia porcellus GN=Ptgr1 PE=1 SV=1 1255 1472 4.0E-08
sp|Q28GQ2|MECR_XENTR Trans-2-enoyl-CoA reductase, mitochondrial OS=Xenopus tropicalis GN=mecr PE=2 SV=1 1178 1462 5.0E-08
sp|Q29073|PTGR1_PIG Prostaglandin reductase 1 OS=Sus scrofa GN=PTGR1 PE=1 SV=1 1272 1472 5.0E-08
sp|Q93X67|FABG2_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 2, chloroplastic OS=Brassica napus GN=bkr2 PE=2 SV=1 1498 1661 5.0E-08
sp|Q82LU9|CCRA2_STRAW Crotonyl-CoA reductase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ccrA2 PE=1 SV=1 1166 1490 5.0E-08
sp|P22414|FOX2_CANTR Peroxisomal hydratase-dehydrogenase-epimerase OS=Candida tropicalis PE=1 SV=2 1498 1661 5.0E-08
sp|Q949M3|FABG3_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 3, chloroplastic OS=Brassica napus GN=bkr3 PE=2 SV=1 1498 1661 8.0E-08
sp|Q9DCS3|MECR_MOUSE Trans-2-enoyl-CoA reductase, mitochondrial OS=Mus musculus GN=Mecr PE=1 SV=2 1178 1306 8.0E-08
sp|Q9SLN8|DBR_TOBAC 2-alkenal reductase (NADP(+)-dependent) OS=Nicotiana tabacum GN=DBR PE=1 SV=1 1272 1472 9.0E-08
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 1492 1663 1.0E-07
sp|Q93X62|FABG1_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 1, chloroplastic OS=Brassica napus GN=gbkr1 PE=1 SV=1 1498 1661 1.0E-07
sp|O95825|QORL1_HUMAN Quinone oxidoreductase-like protein 1 OS=Homo sapiens GN=CRYZL1 PE=1 SV=2 1208 1364 1.0E-07
sp|O23939|ENOX_FRAVE 2-methylene-furan-3-one reductase OS=Fragaria vesca GN=EO PE=2 SV=2 1165 1322 1.0E-07
sp|Q8N4T8|CBR4_HUMAN Carbonyl reductase family member 4 OS=Homo sapiens GN=CBR4 PE=1 SV=3 1499 1653 1.0E-07
sp|P49385|ADH4_KLULA Alcohol dehydrogenase 4, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ADH4 PE=3 SV=2 1238 1472 1.0E-07
sp|Q7YS70|MECR_BOVIN Trans-2-enoyl-CoA reductase, mitochondrial OS=Bos taurus GN=MECR PE=1 SV=1 1177 1306 2.0E-07
sp|O35017|YOGA_BACSU Uncharacterized zinc-type alcohol dehydrogenase-like protein YogA OS=Bacillus subtilis (strain 168) GN=yogA PE=3 SV=1 1178 1387 2.0E-07
sp|Q9SV68|QORH_ARATH Putative quinone-oxidoreductase homolog, chloroplastic OS=Arabidopsis thaliana GN=At4g13010 PE=2 SV=1 1180 1474 3.0E-07
sp|Q6GQN8|MECR_DANRE Trans-2-enoyl-CoA reductase, mitochondrial OS=Danio rerio GN=mecr PE=2 SV=2 1177 1306 3.0E-07
sp|Q14914|PTGR1_HUMAN Prostaglandin reductase 1 OS=Homo sapiens GN=PTGR1 PE=1 SV=2 1272 1382 4.0E-07
sp|Q93X68|FABG5_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 5, chloroplastic (Fragment) OS=Brassica napus GN=bkr1 PE=2 SV=1 1498 1661 4.0E-07
sp|P54006|TOXD_COCCA Protein TOXD OS=Cochliobolus carbonum GN=TOXD PE=3 SV=1 1171 1316 5.0E-07
sp|Q5HM44|ZDH1_STAEQ Zinc-type alcohol dehydrogenase-like protein SERP1785 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP1785 PE=3 SV=1 1208 1321 5.0E-07
sp|P12311|ADH1_GEOSE Alcohol dehydrogenase OS=Geobacillus stearothermophilus GN=adhT PE=1 SV=2 1209 1361 5.0E-07
sp|Q8CRJ7|ZDH1_STAES Zinc-type alcohol dehydrogenase-like protein SE_1777 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_1777 PE=3 SV=1 1208 1321 5.0E-07
sp|Q9C0Y6|YKM8_SCHPO Zinc-type alcohol dehydrogenase-like protein PB24D3.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB24D3.08c PE=3 SV=1 1272 1472 6.0E-07
sp|Q7T3C7|RT4I1_DANRE Reticulon-4-interacting protein 1 homolog, mitochondrial OS=Danio rerio GN=rtn4ip1 PE=2 SV=2 1180 1473 9.0E-07
sp|P28643|FABG_CUPLA 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic OS=Cuphea lanceolata GN=CLKR27 PE=2 SV=1 1498 1707 1.0E-06
sp|Q07288|ADH1_KLUMA Alcohol dehydrogenase 1 OS=Kluyveromyces marxianus GN=ADH1 PE=3 SV=1 1209 1472 1.0E-06
sp|P55336|FABG_VIBHA 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Vibrio harveyi GN=fabG PE=3 SV=1 1498 1660 1.0E-06
sp|O45903|MECR1_CAEEL Probable trans-2-enoyl-CoA reductase 1, mitochondrial OS=Caenorhabditis elegans GN=W09H1.5 PE=3 SV=1 1180 1356 2.0E-06
sp|Q68ER2|CBR4_XENTR Carbonyl reductase family member 4 OS=Xenopus tropicalis GN=cbr4 PE=2 SV=1 1499 1653 2.0E-06
sp|P0AAI9|FABD_ECOLI Malonyl CoA-acyl carrier protein transacylase OS=Escherichia coli (strain K12) GN=fabD PE=1 SV=2 162 336 2.0E-06
sp|P0AAJ0|FABD_ECOL6 Malonyl CoA-acyl carrier protein transacylase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fabD PE=3 SV=2 162 336 2.0E-06
sp|P73826|FABG2_SYNY3 3-oxoacyl-[acyl-carrier-protein] reductase 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabG2 PE=1 SV=1 1489 1661 2.0E-06
sp|P0A0I0|FABG_STAAW 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MW2) GN=fabG PE=3 SV=1 1491 1645 3.0E-06
sp|Q6G9Y2|FABG_STAAS 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MSSA476) GN=fabG PE=3 SV=1 1491 1645 3.0E-06
sp|Q6GHK4|FABG_STAAR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MRSA252) GN=fabG PE=3 SV=1 1491 1645 3.0E-06
sp|P99093|FABG_STAAN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain N315) GN=fabG PE=1 SV=1 1491 1645 3.0E-06
sp|P0A0H9|FABG_STAAM 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabG PE=1 SV=1 1491 1645 3.0E-06
sp|Q5HGK2|FABG_STAAC 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain COL) GN=fabG PE=3 SV=2 1491 1645 3.0E-06
sp|P51659|DHB4_HUMAN Peroxisomal multifunctional enzyme type 2 OS=Homo sapiens GN=HSD17B4 PE=1 SV=3 1489 1647 3.0E-06
sp|Q8X8I7|FABD_ECO57 Malonyl CoA-acyl carrier protein transacylase OS=Escherichia coli O157:H7 GN=fabD PE=3 SV=3 162 342 4.0E-06
sp|Q9V6U9|MECR_DROME Probable trans-2-enoyl-CoA reductase, mitochondrial OS=Drosophila melanogaster GN=CG16935 PE=3 SV=2 1179 1310 5.0E-06
sp|Q6GEP3|ZDH1_STAAR Zinc-type alcohol dehydrogenase-like protein SAR2277 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2277 PE=3 SV=1 1179 1316 8.0E-06
sp|P71534|FABG_MYCS2 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=fabG PE=3 SV=2 1496 1650 8.0E-06
sp|Q8NVD1|ZDH1_STAAW Zinc-type alcohol dehydrogenase-like protein MW2112 OS=Staphylococcus aureus (strain MW2) GN=MW2112 PE=3 SV=1 1179 1316 9.0E-06
sp|Q6G7C8|ZDH1_STAAS Zinc-type alcohol dehydrogenase-like protein SAS2087 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2087 PE=3 SV=1 1179 1316 9.0E-06
sp|Q6NUE2|CBR4_XENLA Carbonyl reductase family member 4 OS=Xenopus laevis GN=cbr4 PE=2 SV=1 1499 1653 9.0E-06
sp|Q54YT4|MECR_DICDI Trans-2-enoyl-CoA reductase, mitochondrial OS=Dictyostelium discoideum GN=mecr PE=3 SV=1 1171 1387 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0055114 oxidation-reduction process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 56 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5301
MLEKGFILPNINFEKANESIPLNEWNMKVPTGIRSWPASKTLVSVNNFGFGGSNAHCVLQRPALDLGRGIRKPSD
GDQPKLLVMSGNREEAVEERAKQLGIYAEQHPEVFQKSLIRDLAYTLCERRSHMPWRTAVVGSCLTDIVKSLNGA
ETKPQRASSSPKIAFIFTGQGAQWYAMGRELMKSHTVFAETMQAADDCLRHLGASFSLLEELNKDKEHSEVGKAH
LSQPACTAIQLALVRLLSSWGIEPLAVIGHSSGEIGAAFATGAISVEDAMAIAYFRGQVTLRMKAQHPHLRGAML
AVGASPTEVRKIIKTLSLQGAAVACENSPASVTVSGDASDIDALASELESRQIFNRKLHVDVAYHSTHMELVASE
YFKAIENVTASGGSKAAFFSSLRGTALASGSMLTADYWTDNLVKPVLFSPALQALCREVQPTVLVEIGPHAALEG
PVKQILREMGGQATGIKYCPSLVRNEHATVAALKMAGNLYVMGQKVAFDEINNTSDVSDVPSLIDDLAPYPWADE
KHWREPRQSREHRFKPFGRHDLLGLINGTSNDTEHNWQGVLSTDEIPWLREHKMQSLTTFPLTGFLCMVTEAAAQ
RASLRNITFERFCMREIQVTSPLIMNDGDEYEMKISLRRHAEGTRSLSNEWDDFLVSSWAASRGWIDHCRGLVAV
RKQQSPSPVGNHVQQDSRKRLLRASELCTKSVSQDDFYPHLQSVGAEYGPIFRMKDGESMKCGGGHSMHSIQVRD
TASTMPFNYETKSILSATLIDTLVQASFILLGAGQGGMPILYMPNGIKTLEFNKTLPTAPGEEALVVCEGYPDTA
NLTPTDFSYDMWDPQNQSQPLLSMKGLTMIPVTEQNTKELEPASLCYKVEWEDLYKAGVEVNGTNGHVNGTNGHA
SDDNGHINGINGHVNGTNGHINNGANGHVHETKGHVNGTNGHSNGTNGHVDSSNEPFAAPVVIVSDMGENDSLVQ
SLMDLLLLKIGVTATVCPLDRLDASGKICVALCELNRPVIANITAKGFQKLQSILLTANAVLWVSSGTYKNAKNP
ENALAHGLFRTVRSEAGKLAATLDLDPDSRLDNDSRSELVLQALKSVLAAGEESSPSDFEFAETQGKLVVPRVVE
DGRMNEVIQRYTRPNLPHLQPFDQGDRRLEIAIGMRGALDSLYFRDQIVGPLGDDQVEIKIIATGMNFKDVVIAM
GQVSSSYLGVECSGIISKVGSKVTSLSVGDRVCAMSLGAYGTFARCKATSAAVIPDNMSTEVAASIPVVYSTAYY
GMIELAHLEPGESILIHAASGGVGQAAIQLAKLIGAEVFATVGSADKKILIMEKYGIPENRIFYSRNPEFGPAIR
EATGGRGVDVVLNSLAGELLRESWECLAHFGRFIEIGKRDISSNTGLGMGQFEHNVTFSSVDLTLVAKERPKIMG
RVLNSVMDLLKQKKISAIEPITVMGISELETALRTLQGGKSTGKIVIAPRAGEQVKATHRHATSLLKHNATYVII
GGTGGLGRSMAKRMVERGAKHIVLLSRNGHMTTELSNLSKDCLAHGATIVVKSCDVTDEGSVKQLIDECAKTLPP
VRGIVHAAMVLRDMLFEKMAFEDFQKVVEAKVSGTWHFHRALSEQQLDFFVVLSSVAGIVGNRGQAAYAAANTFL
DAFVQHRIQQGLPAASIDLTAVEGVGYLAENAARSKEVLQSLSGTTFGEAEVLALIEASFDGQISRLCNSQCITG
LNFEGQSLPYYAEDARFSHLRDAFLEKNKICNAPGSGSQVPSQEEVARAATYDEAVAIVTHKMWDKLCAILMLPP
QDTDPDSTVKSYGLDSLNAIELRNWIAKEYLAHLQVLELLTSGTIRDLAGLVLKKTKIKHGYKNP*
Coding >Hirsu2|5301
ATGCTTGAGAAGGGCTTCATTCTGCCCAATATCAACTTTGAAAAGGCAAACGAGAGCATCCCGCTCAACGAGTGG
AACATGAAGGTCCCGACCGGCATTCGATCTTGGCCAGCGTCCAAAACCCTCGTCAGCGTCAACAACTTCGGTTTC
GGAGGCTCAAACGCTCATTGCGTGCTGCAAAGGCCAGCTCTTGATCTCGGTAGGGGAATTCGGAAACCCTCGGAC
GGTGATCAGCCCAAGTTACTCGTCATGTCGGGTAACCGGGAAGAAGCCGTAGAAGAGAGAGCCAAACAGCTCGGC
ATCTACGCGGAGCAACATCCCGAAGTCTTCCAAAAATCCCTGATCCGAGACCTTGCCTACACCCTCTGCGAACGT
CGGTCACATATGCCCTGGCGCACGGCAGTGGTCGGGTCGTGCCTCACTGACATTGTCAAGTCCCTAAACGGCGCC
GAGACCAAGCCGCAGCGCGCCTCGAGCTCACCAAAAATAGCATTCATATTCACCGGACAGGGAGCTCAATGGTAC
GCCATGGGTCGAGAGCTCATGAAGTCTCACACCGTGTTCGCCGAGACCATGCAAGCCGCCGACGACTGCCTCAGG
CACCTTGGCGCTAGCTTTTCGCTCCTCGAAGAGCTGAACAAGGACAAGGAGCATTCCGAGGTGGGCAAGGCTCAT
CTCAGCCAGCCGGCCTGTACTGCTATCCAACTGGCCCTGGTAAGGTTGCTGTCCTCGTGGGGAATCGAACCTCTG
GCCGTCATTGGCCACTCCAGTGGAGAGATTGGCGCGGCCTTTGCCACTGGCGCCATCTCCGTCGAGGATGCCATG
GCCATCGCTTACTTCCGAGGCCAAGTTACTCTTCGAATGAAGGCGCAACACCCTCATCTCCGCGGCGCTATGCTT
GCTGTTGGCGCAAGCCCTACCGAGGTGCGGAAGATCATCAAGACGTTATCCCTGCAGGGTGCTGCCGTCGCATGC
GAAAACTCCCCAGCTTCGGTAACGGTATCTGGCGACGCGAGCGATATTGATGCTCTCGCGTCCGAGCTGGAGAGT
AGGCAGATTTTCAACCGCAAGCTTCACGTCGACGTTGCTTATCACTCCACGCACATGGAGCTGGTAGCGAGCGAG
TATTTCAAGGCCATTGAAAATGTGACAGCATCCGGCGGAAGCAAAGCTGCCTTCTTCTCTTCTCTGCGAGGGACG
GCCCTGGCCAGTGGCTCCATGCTCACGGCGGACTACTGGACAGACAACTTGGTCAAACCGGTTTTGTTTTCCCCT
GCACTGCAGGCTCTATGCAGAGAGGTTCAGCCGACGGTCTTGGTTGAGATTGGCCCTCATGCCGCTCTTGAGGGT
CCTGTGAAGCAGATACTCCGCGAAATGGGTGGCCAGGCGACGGGCATCAAGTACTGCCCCAGTCTGGTTCGCAAT
GAGCATGCCACGGTGGCAGCCCTCAAAATGGCTGGCAATCTCTATGTCATGGGTCAGAAGGTTGCCTTCGACGAG
ATAAACAACACATCCGACGTTTCTGACGTACCAAGTCTCATCGATGACCTCGCTCCATATCCATGGGCGGATGAG
AAACACTGGCGCGAGCCTCGTCAGAGCAGGGAACATCGCTTCAAGCCTTTTGGCAGACACGACCTCCTGGGTCTG
ATCAACGGCACGTCTAACGACACCGAGCACAACTGGCAAGGAGTCCTGAGCACAGACGAAATCCCTTGGCTCCGG
GAGCACAAGATGCAATCTTTGACGACCTTTCCCTTGACTGGCTTTCTTTGCATGGTCACCGAAGCGGCAGCTCAG
CGTGCGAGCCTGCGAAACATCACGTTTGAGCGATTCTGCATGAGAGAAATCCAGGTGACCTCACCTCTCATCATG
AATGATGGCGACGAATATGAGATGAAGATCAGTCTTCGGCGACATGCTGAGGGTACCCGCTCGCTTTCAAACGAG
TGGGATGACTTCCTGGTCTCATCCTGGGCTGCCAGCAGGGGCTGGATCGACCATTGCAGGGGTCTGGTTGCTGTT
CGGAAGCAGCAGTCCCCGAGCCCGGTTGGAAACCACGTCCAACAGGATAGCCGCAAACGTCTTCTCAGGGCCTCT
GAGCTCTGCACAAAGTCGGTCAGCCAGGACGACTTCTACCCTCACCTTCAATCCGTGGGGGCTGAATACGGTCCG
ATCTTCCGCATGAAGGACGGCGAGAGCATGAAGTGCGGTGGCGGTCATAGTATGCACTCGATTCAGGTTCGCGAT
ACTGCCTCGACCATGCCCTTCAATTATGAGACCAAGTCGATTCTCTCGGCGACTCTCATAGACACTCTCGTTCAA
GCTTCGTTCATCCTTTTAGGCGCGGGTCAAGGCGGGATGCCCATCCTATACATGCCCAACGGCATCAAGACCCTT
GAATTCAACAAAACTCTCCCGACAGCACCTGGTGAAGAAGCGCTTGTTGTCTGCGAAGGTTATCCAGACACCGCC
AACCTGACTCCTACAGACTTCTCCTACGACATGTGGGATCCGCAAAACCAGTCGCAACCGTTGCTCAGCATGAAG
GGCTTGACCATGATTCCGGTTACTGAGCAAAACACAAAGGAACTTGAGCCTGCGTCGCTTTGCTACAAGGTGGAA
TGGGAGGATCTCTACAAGGCAGGGGTGGAAGTGAACGGCACCAACGGACACGTCAATGGCACCAATGGGCACGCG
AGTGACGACAACGGACACATCAACGGCATAAACGGGCATGTGAATGGCACCAATGGGCACATCAACAATGGCGCC
AATGGCCATGTTCATGAAACTAAAGGGCACGTCAACGGCACCAACGGCCACTCAAATGGTACCAACGGCCACGTC
GACAGCTCGAACGAGCCCTTCGCGGCTCCTGTCGTGATTGTTTCCGATATGGGTGAGAATGATTCACTGGTTCAG
TCGCTTATGGATCTCCTCCTCCTCAAAATAGGCGTCACTGCGACCGTATGTCCACTTGATAGGCTTGACGCCTCG
GGCAAGATTTGCGTGGCGCTTTGCGAGCTGAATCGCCCAGTCATTGCGAACATTACCGCCAAGGGGTTCCAAAAG
CTTCAAAGCATCCTTCTCACCGCTAATGCTGTGCTTTGGGTCAGTTCTGGAACCTACAAGAATGCCAAGAACCCG
GAAAATGCATTGGCGCATGGTCTTTTCCGGACCGTGCGGTCGGAGGCGGGCAAACTTGCTGCCACGTTGGATCTT
GATCCTGATTCTCGACTGGACAACGACTCTCGATCCGAGCTGGTTCTTCAGGCACTGAAAAGTGTCCTGGCAGCT
GGGGAGGAGAGCTCGCCGTCTGATTTCGAATTTGCTGAAACGCAGGGAAAACTCGTCGTTCCTCGAGTCGTCGAG
GATGGTCGCATGAATGAAGTCATTCAGCGCTACACACGGCCAAACCTCCCGCATTTACAACCCTTCGACCAGGGC
GACCGCCGGCTGGAAATTGCCATCGGTATGCGTGGAGCCCTGGACTCCCTCTATTTCCGCGACCAGATTGTCGGT
CCCCTCGGCGATGATCAGGTGGAGATTAAGATCATCGCAACCGGCATGAACTTCAAGGACGTCGTCATTGCCATG
GGCCAAGTGAGCAGCTCGTACCTCGGTGTCGAGTGCAGTGGTATCATCTCGAAGGTGGGTAGCAAGGTGACCTCT
CTATCCGTCGGAGATCGAGTTTGCGCTATGTCGCTCGGCGCGTACGGCACTTTTGCAAGATGCAAGGCGACAAGC
GCGGCTGTTATTCCCGATAATATGTCGACAGAAGTTGCAGCATCGATCCCGGTCGTATACTCAACAGCATATTAC
GGCATGATCGAGCTCGCCCATCTTGAGCCGGGCGAGAGTATCCTAATCCACGCTGCCTCGGGTGGCGTTGGACAG
GCCGCTATTCAACTGGCGAAGCTTATAGGAGCTGAGGTCTTCGCGACTGTTGGAAGCGCCGATAAAAAGATTCTG
ATCATGGAAAAGTACGGCATTCCGGAGAACCGTATCTTCTACAGTCGCAATCCGGAGTTCGGCCCTGCTATTCGC
GAGGCTACTGGCGGCCGAGGTGTCGATGTGGTCCTCAATTCTCTGGCCGGAGAGCTCTTGAGAGAATCCTGGGAG
TGCCTGGCGCATTTCGGCCGATTTATCGAGATTGGAAAGAGGGACATATCTTCGAACACGGGCCTAGGAATGGGC
CAGTTCGAACATAACGTGACATTTAGCTCTGTCGACCTGACGCTTGTTGCCAAGGAGAGACCAAAGATCATGGGC
CGCGTCCTGAACTCGGTCATGGACCTGCTGAAGCAGAAGAAAATCTCCGCCATCGAGCCCATAACCGTCATGGGT
ATCTCAGAGCTTGAGACGGCCTTGCGGACTCTTCAGGGCGGAAAGTCGACCGGTAAAATCGTGATCGCGCCCCGT
GCTGGGGAGCAGGTGAAGGCAACGCACCGACATGCCACGAGTCTCTTGAAGCATAACGCAACCTACGTCATTATC
GGCGGCACTGGCGGCTTAGGGCGATCCATGGCCAAGCGGATGGTGGAGCGCGGCGCGAAACATATTGTGCTGTTG
TCTCGAAATGGCCATATGACGACGGAACTGTCTAACCTGAGCAAAGACTGCCTTGCCCACGGGGCCACGATTGTC
GTCAAGTCGTGCGATGTGACTGATGAGGGCAGCGTCAAGCAGCTTATTGATGAGTGCGCCAAGACGCTGCCCCCT
GTCCGTGGTATTGTCCACGCGGCCATGGTCCTTAGGGATATGCTGTTTGAGAAGATGGCGTTTGAAGATTTCCAG
AAAGTCGTTGAAGCCAAGGTTTCGGGTACTTGGCATTTCCACCGCGCTCTGAGTGAGCAGCAGCTCGACTTCTTC
GTTGTTCTTTCCTCAGTTGCAGGCATTGTGGGCAACAGGGGTCAAGCTGCATACGCAGCGGCAAATACTTTCCTC
GACGCATTCGTTCAGCACAGGATACAGCAGGGCCTGCCAGCAGCTTCCATTGACCTGACGGCGGTTGAAGGGGTC
GGATACCTGGCAGAGAATGCCGCACGATCCAAGGAGGTACTGCAGAGTCTTTCCGGTACCACATTTGGCGAAGCG
GAGGTTCTCGCACTCATCGAGGCGAGTTTCGACGGTCAGATCTCGAGGCTCTGCAACAGCCAGTGCATTACAGGC
CTGAACTTTGAGGGCCAGTCGCTGCCGTACTATGCCGAGGATGCCAGGTTTTCCCACCTCCGCGACGCATTCCTG
GAGAAAAACAAGATCTGCAATGCGCCAGGATCAGGGAGCCAGGTGCCTTCTCAGGAAGAGGTCGCTCGTGCAGCC
ACGTACGACGAGGCTGTCGCGATTGTCACTCACAAAATGTGGGACAAGCTCTGCGCTATCCTCATGCTGCCGCCC
CAAGACACAGATCCTGACAGTACTGTGAAATCGTACGGCTTGGACTCGTTGAACGCCATCGAGCTTCGAAACTGG
ATCGCCAAGGAATATCTTGCACATCTCCAGGTGCTCGAGCTCCTGACATCGGGCACAATCCGAGACCTGGCAGGA
CTCGTCCTGAAGAAGACCAAAATCAAGCATGGATACAAAAACCCCTGA
Transcript >Hirsu2|5301
ATGCTTGAGAAGGGCTTCATTCTGCCCAATATCAACTTTGAAAAGGCAAACGAGAGCATCCCGCTCAACGAGTGG
AACATGAAGGTCCCGACCGGCATTCGATCTTGGCCAGCGTCCAAAACCCTCGTCAGCGTCAACAACTTCGGTTTC
GGAGGCTCAAACGCTCATTGCGTGCTGCAAAGGCCAGCTCTTGATCTCGGTAGGGGAATTCGGAAACCCTCGGAC
GGTGATCAGCCCAAGTTACTCGTCATGTCGGGTAACCGGGAAGAAGCCGTAGAAGAGAGAGCCAAACAGCTCGGC
ATCTACGCGGAGCAACATCCCGAAGTCTTCCAAAAATCCCTGATCCGAGACCTTGCCTACACCCTCTGCGAACGT
CGGTCACATATGCCCTGGCGCACGGCAGTGGTCGGGTCGTGCCTCACTGACATTGTCAAGTCCCTAAACGGCGCC
GAGACCAAGCCGCAGCGCGCCTCGAGCTCACCAAAAATAGCATTCATATTCACCGGACAGGGAGCTCAATGGTAC
GCCATGGGTCGAGAGCTCATGAAGTCTCACACCGTGTTCGCCGAGACCATGCAAGCCGCCGACGACTGCCTCAGG
CACCTTGGCGCTAGCTTTTCGCTCCTCGAAGAGCTGAACAAGGACAAGGAGCATTCCGAGGTGGGCAAGGCTCAT
CTCAGCCAGCCGGCCTGTACTGCTATCCAACTGGCCCTGGTAAGGTTGCTGTCCTCGTGGGGAATCGAACCTCTG
GCCGTCATTGGCCACTCCAGTGGAGAGATTGGCGCGGCCTTTGCCACTGGCGCCATCTCCGTCGAGGATGCCATG
GCCATCGCTTACTTCCGAGGCCAAGTTACTCTTCGAATGAAGGCGCAACACCCTCATCTCCGCGGCGCTATGCTT
GCTGTTGGCGCAAGCCCTACCGAGGTGCGGAAGATCATCAAGACGTTATCCCTGCAGGGTGCTGCCGTCGCATGC
GAAAACTCCCCAGCTTCGGTAACGGTATCTGGCGACGCGAGCGATATTGATGCTCTCGCGTCCGAGCTGGAGAGT
AGGCAGATTTTCAACCGCAAGCTTCACGTCGACGTTGCTTATCACTCCACGCACATGGAGCTGGTAGCGAGCGAG
TATTTCAAGGCCATTGAAAATGTGACAGCATCCGGCGGAAGCAAAGCTGCCTTCTTCTCTTCTCTGCGAGGGACG
GCCCTGGCCAGTGGCTCCATGCTCACGGCGGACTACTGGACAGACAACTTGGTCAAACCGGTTTTGTTTTCCCCT
GCACTGCAGGCTCTATGCAGAGAGGTTCAGCCGACGGTCTTGGTTGAGATTGGCCCTCATGCCGCTCTTGAGGGT
CCTGTGAAGCAGATACTCCGCGAAATGGGTGGCCAGGCGACGGGCATCAAGTACTGCCCCAGTCTGGTTCGCAAT
GAGCATGCCACGGTGGCAGCCCTCAAAATGGCTGGCAATCTCTATGTCATGGGTCAGAAGGTTGCCTTCGACGAG
ATAAACAACACATCCGACGTTTCTGACGTACCAAGTCTCATCGATGACCTCGCTCCATATCCATGGGCGGATGAG
AAACACTGGCGCGAGCCTCGTCAGAGCAGGGAACATCGCTTCAAGCCTTTTGGCAGACACGACCTCCTGGGTCTG
ATCAACGGCACGTCTAACGACACCGAGCACAACTGGCAAGGAGTCCTGAGCACAGACGAAATCCCTTGGCTCCGG
GAGCACAAGATGCAATCTTTGACGACCTTTCCCTTGACTGGCTTTCTTTGCATGGTCACCGAAGCGGCAGCTCAG
CGTGCGAGCCTGCGAAACATCACGTTTGAGCGATTCTGCATGAGAGAAATCCAGGTGACCTCACCTCTCATCATG
AATGATGGCGACGAATATGAGATGAAGATCAGTCTTCGGCGACATGCTGAGGGTACCCGCTCGCTTTCAAACGAG
TGGGATGACTTCCTGGTCTCATCCTGGGCTGCCAGCAGGGGCTGGATCGACCATTGCAGGGGTCTGGTTGCTGTT
CGGAAGCAGCAGTCCCCGAGCCCGGTTGGAAACCACGTCCAACAGGATAGCCGCAAACGTCTTCTCAGGGCCTCT
GAGCTCTGCACAAAGTCGGTCAGCCAGGACGACTTCTACCCTCACCTTCAATCCGTGGGGGCTGAATACGGTCCG
ATCTTCCGCATGAAGGACGGCGAGAGCATGAAGTGCGGTGGCGGTCATAGTATGCACTCGATTCAGGTTCGCGAT
ACTGCCTCGACCATGCCCTTCAATTATGAGACCAAGTCGATTCTCTCGGCGACTCTCATAGACACTCTCGTTCAA
GCTTCGTTCATCCTTTTAGGCGCGGGTCAAGGCGGGATGCCCATCCTATACATGCCCAACGGCATCAAGACCCTT
GAATTCAACAAAACTCTCCCGACAGCACCTGGTGAAGAAGCGCTTGTTGTCTGCGAAGGTTATCCAGACACCGCC
AACCTGACTCCTACAGACTTCTCCTACGACATGTGGGATCCGCAAAACCAGTCGCAACCGTTGCTCAGCATGAAG
GGCTTGACCATGATTCCGGTTACTGAGCAAAACACAAAGGAACTTGAGCCTGCGTCGCTTTGCTACAAGGTGGAA
TGGGAGGATCTCTACAAGGCAGGGGTGGAAGTGAACGGCACCAACGGACACGTCAATGGCACCAATGGGCACGCG
AGTGACGACAACGGACACATCAACGGCATAAACGGGCATGTGAATGGCACCAATGGGCACATCAACAATGGCGCC
AATGGCCATGTTCATGAAACTAAAGGGCACGTCAACGGCACCAACGGCCACTCAAATGGTACCAACGGCCACGTC
GACAGCTCGAACGAGCCCTTCGCGGCTCCTGTCGTGATTGTTTCCGATATGGGTGAGAATGATTCACTGGTTCAG
TCGCTTATGGATCTCCTCCTCCTCAAAATAGGCGTCACTGCGACCGTATGTCCACTTGATAGGCTTGACGCCTCG
GGCAAGATTTGCGTGGCGCTTTGCGAGCTGAATCGCCCAGTCATTGCGAACATTACCGCCAAGGGGTTCCAAAAG
CTTCAAAGCATCCTTCTCACCGCTAATGCTGTGCTTTGGGTCAGTTCTGGAACCTACAAGAATGCCAAGAACCCG
GAAAATGCATTGGCGCATGGTCTTTTCCGGACCGTGCGGTCGGAGGCGGGCAAACTTGCTGCCACGTTGGATCTT
GATCCTGATTCTCGACTGGACAACGACTCTCGATCCGAGCTGGTTCTTCAGGCACTGAAAAGTGTCCTGGCAGCT
GGGGAGGAGAGCTCGCCGTCTGATTTCGAATTTGCTGAAACGCAGGGAAAACTCGTCGTTCCTCGAGTCGTCGAG
GATGGTCGCATGAATGAAGTCATTCAGCGCTACACACGGCCAAACCTCCCGCATTTACAACCCTTCGACCAGGGC
GACCGCCGGCTGGAAATTGCCATCGGTATGCGTGGAGCCCTGGACTCCCTCTATTTCCGCGACCAGATTGTCGGT
CCCCTCGGCGATGATCAGGTGGAGATTAAGATCATCGCAACCGGCATGAACTTCAAGGACGTCGTCATTGCCATG
GGCCAAGTGAGCAGCTCGTACCTCGGTGTCGAGTGCAGTGGTATCATCTCGAAGGTGGGTAGCAAGGTGACCTCT
CTATCCGTCGGAGATCGAGTTTGCGCTATGTCGCTCGGCGCGTACGGCACTTTTGCAAGATGCAAGGCGACAAGC
GCGGCTGTTATTCCCGATAATATGTCGACAGAAGTTGCAGCATCGATCCCGGTCGTATACTCAACAGCATATTAC
GGCATGATCGAGCTCGCCCATCTTGAGCCGGGCGAGAGTATCCTAATCCACGCTGCCTCGGGTGGCGTTGGACAG
GCCGCTATTCAACTGGCGAAGCTTATAGGAGCTGAGGTCTTCGCGACTGTTGGAAGCGCCGATAAAAAGATTCTG
ATCATGGAAAAGTACGGCATTCCGGAGAACCGTATCTTCTACAGTCGCAATCCGGAGTTCGGCCCTGCTATTCGC
GAGGCTACTGGCGGCCGAGGTGTCGATGTGGTCCTCAATTCTCTGGCCGGAGAGCTCTTGAGAGAATCCTGGGAG
TGCCTGGCGCATTTCGGCCGATTTATCGAGATTGGAAAGAGGGACATATCTTCGAACACGGGCCTAGGAATGGGC
CAGTTCGAACATAACGTGACATTTAGCTCTGTCGACCTGACGCTTGTTGCCAAGGAGAGACCAAAGATCATGGGC
CGCGTCCTGAACTCGGTCATGGACCTGCTGAAGCAGAAGAAAATCTCCGCCATCGAGCCCATAACCGTCATGGGT
ATCTCAGAGCTTGAGACGGCCTTGCGGACTCTTCAGGGCGGAAAGTCGACCGGTAAAATCGTGATCGCGCCCCGT
GCTGGGGAGCAGGTGAAGGCAACGCACCGACATGCCACGAGTCTCTTGAAGCATAACGCAACCTACGTCATTATC
GGCGGCACTGGCGGCTTAGGGCGATCCATGGCCAAGCGGATGGTGGAGCGCGGCGCGAAACATATTGTGCTGTTG
TCTCGAAATGGCCATATGACGACGGAACTGTCTAACCTGAGCAAAGACTGCCTTGCCCACGGGGCCACGATTGTC
GTCAAGTCGTGCGATGTGACTGATGAGGGCAGCGTCAAGCAGCTTATTGATGAGTGCGCCAAGACGCTGCCCCCT
GTCCGTGGTATTGTCCACGCGGCCATGGTCCTTAGGGATATGCTGTTTGAGAAGATGGCGTTTGAAGATTTCCAG
AAAGTCGTTGAAGCCAAGGTTTCGGGTACTTGGCATTTCCACCGCGCTCTGAGTGAGCAGCAGCTCGACTTCTTC
GTTGTTCTTTCCTCAGTTGCAGGCATTGTGGGCAACAGGGGTCAAGCTGCATACGCAGCGGCAAATACTTTCCTC
GACGCATTCGTTCAGCACAGGATACAGCAGGGCCTGCCAGCAGCTTCCATTGACCTGACGGCGGTTGAAGGGGTC
GGATACCTGGCAGAGAATGCCGCACGATCCAAGGAGGTACTGCAGAGTCTTTCCGGTACCACATTTGGCGAAGCG
GAGGTTCTCGCACTCATCGAGGCGAGTTTCGACGGTCAGATCTCGAGGCTCTGCAACAGCCAGTGCATTACAGGC
CTGAACTTTGAGGGCCAGTCGCTGCCGTACTATGCCGAGGATGCCAGGTTTTCCCACCTCCGCGACGCATTCCTG
GAGAAAAACAAGATCTGCAATGCGCCAGGATCAGGGAGCCAGGTGCCTTCTCAGGAAGAGGTCGCTCGTGCAGCC
ACGTACGACGAGGCTGTCGCGATTGTCACTCACAAAATGTGGGACAAGCTCTGCGCTATCCTCATGCTGCCGCCC
CAAGACACAGATCCTGACAGTACTGTGAAATCGTACGGCTTGGACTCGTTGAACGCCATCGAGCTTCGAAACTGG
ATCGCCAAGGAATATCTTGCACATCTCCAGGTGCTCGAGCTCCTGACATCGGGCACAATCCGAGACCTGGCAGGA
CTCGTCCTGAAGAAGACCAAAATCAAGCATGGATACAAAAACCCCTGA
Gene >Hirsu2|5301
ATGCTTGAGAAGGGCTTCATTCTGCCCAATATCAACTTTGAAAAGGCAAACGAGAGCATCCCGCTCAACGAGTGG
AACATGAAGGTGAGTTATCTTAAGGCCAGTTGAAGAAGACATGCCACTCACAGAATGCGAATCCAACTCAATCCA
GGTCCCGACCGGCATTCGATCTTGGCCAGCGTCCAAAACCCTCGTCAGCGTCAACAACTTCGGTTTCGGAGGCTC
AAACGCTCATTGCGTGCTGCAAAGGCCAGCTCTTGATCTCGGTAGGGGAATTCGGAAACCCTCGGACGGTGATCA
GCCCAAGTTACTCGTCATGTCGGGTAACCGGGAAGAAGCCGTAGAAGAGAGAGCCAAACAGCTCGGCATCTACGC
GGAGCAACATCCCGAAGTCTTCCAAAAATCCCTGATCCGAGACCTTGCCTACACCCTCTGCGAACGTCGGTCACA
TATGCCCTGGCGCACGGCAGTGGTCGGGTCGTGCCTCACTGACATTGTCAAGTCCCTAAACGGCGCCGAGACCAA
GCCGCAGCGCGCCTCGAGCTCACCAAAAATAGCATTCATATTCACCGGACAGGGAGCTCAATGGTACGCCATGGG
TCGAGAGCTCATGAAGTCTCACACCGTGTTCGCCGAGACCATGCAAGCCGCCGACGACTGCCTCAGGCACCTTGG
CGCTAGCTTTTCGCTCCTCGAAGAGCTGAACAAGGACAAGGAGCATTCCGAGGTGGGCAAGGCTCATCTCAGCCA
GCCGGCCTGTACTGCTATCCAACTGGCCCTGGTAAGGTTGCTGTCCTCGTGGGGAATCGAACCTCTGGCCGTCAT
TGGCCACTCCAGTGGAGAGATTGGCGCGGCCTTTGCCACTGGCGCCATCTCCGTCGAGGATGCCATGGCCATCGC
TTACTTCCGAGGCCAAGTTACTCTTCGAATGAAGGCGCAACACCCTCATCTCCGCGGCGCTATGCTTGCTGTTGG
CGCAAGCCCTACCGAGGTGCGGAAGATCATCAAGACGTTATCCCTGCAGGGTGCTGCCGTCGCATGCGAAAACTC
CCCAGCTTCGGTAACGGTATCTGGCGACGCGAGCGATATTGATGCTCTCGCGTCCGAGCTGGAGAGTAGGCAGAT
TTTCAACCGCAAGCTTCACGTCGACGTTGCTTATCACTCCACGCACATGGAGCTGGTAGCGAGCGAGTATTTCAA
GGCCATTGAAAATGTGACAGCATCCGGCGGAAGCAAAGCTGCCTTCTTCTCTTCTCTGCGAGGGACGGCCCTGGC
CAGTGGCTCCATGCTCACGGCGGACTACTGGACAGACAACTTGGTCAAACCGGTTTTGTTTTCCCCTGCACTGCA
GGCTCTATGCAGAGAGGTTCAGCCGACGGTCTTGGTTGAGATTGGCCCTCATGCCGCTCTTGAGGGTCCTGTGAA
GCAGATACTCCGCGAAATGGGTGGCCAGGCGACGGGCATCAAGTACTGCCCCAGTCTGGTTCGCAATGAGCATGC
CACGGTGGCAGCCCTCAAAATGGCTGGCAATCTCTATGTCATGGGTCAGAAGGTTGCCTTCGACGAGATAAACAA
CACATCCGACGTTTCTGACGTACCAAGTCTCATCGATGACCTCGCTCCATATCCATGGGCGGATGAGAAACACTG
GCGCGAGCCTCGTCAGAGCAGGGAACATCGCTTCAAGCCTTTTGGCAGACACGACCTCCTGGGTCTGATCAACGG
CACGTCTAACGACACCGAGCACAACTGGCAAGGAGTCCTGAGCACAGACGAAATCCCTTGGCTCCGGGAGCACAA
GATGCAATCTTTGACGACCTTTCCCTTGACTGGCTTTCTTTGCATGGTCACCGAAGCGGCAGCTCAGCGTGCGAG
CCTGCGAAACATCACGTTTGAGCGATTCTGCATGAGAGAAATCCAGGTGACCTCACCTCTCATCATGAATGATGG
CGACGAATATGAGATGAAGATCAGTCTTCGGCGACATGCTGAGGGTACCCGCTCGCTTTCAAACGAGTGGGATGA
CTTCCTGGTCTCATCCTGGGCTGCCAGCAGGGGCTGGATCGACCATTGCAGGGGTCTGGTTGCTGTTCGGAAGCA
GCAGTCCCCGAGCCCGGTTGGAAACCACGTCCAACAGGATAGCCGCAAACGTCTTCTCAGGGCCTCTGAGCTCTG
CACAAAGTCGGTCAGCCAGGACGACTTCTACCCTCACCTTCAATCCGTGGGGGCTGAATACGGTCCGATCTTCCG
CATGAAGGACGGCGAGAGCATGAAGTGCGGTGGCGGTCATAGTATGCACTCGATTCAGGTTCGCGATACTGCCTC
GACCATGCCCTTCAATTATGAGACCAAGTCGATTCTCTCGGCGACTCTCATAGACACTCTCGTTCAAGCTTCGTT
CATCCTTTTAGGCGCGGGTCAAGGCGGGATGCCCATCCTATACATGCCCAACGGCATCAAGACCCTTGAATTCAA
CAAAACTCTCCCGACAGCACCTGGTGAAGAAGCGCTTGTTGTCTGCGAAGGTTATCCAGACACCGCCAACCTGAC
TCCTACAGACTTCTCCTACGACATGTGGGATCCGCAAAACCAGTCGCAACCGTTGCTCAGCATGAAGGGCTTGAC
CATGATTCCGGTTACTGAGCAAAACACAAAGGAACTTGAGCCTGCGTCGCTTTGCTACAAGGTGGAATGGGAGGA
TCTCTACAAGGCAGGGGTGGAAGTGAACGGCACCAACGGACACGTCAATGGCACCAATGGGCACGCGAGTGACGA
CAACGGACACATCAACGGCATAAACGGGCATGTGAATGGCACCAATGGGCACATCAACAATGGCGCCAATGGCCA
TGTTCATGAAACTAAAGGGCACGTCAACGGCACCAACGGCCACTCAAATGGTACCAACGGCCACGTCGACAGCTC
GAACGAGCCCTTCGCGGCTCCTGTCGTGATTGTTTCCGATATGGGTGAGAATGATTCACTGGTTCAGTCGCTTAT
GGATCTCCTCCTCCTCAAAATAGGCGTCACTGCGACCGTATGTCCACTTGATAGGCTTGACGCCTCGGGCAAGAT
TTGCGTGGCGCTTTGCGAGCTGAATCGCCCAGTCATTGCGAACATTACCGCCAAGGGGTTCCAAAAGCTTCAAAG
CATCCTTCTCACCGCTAATGCTGTGCTTTGGGTCAGTTCTGGAACCTACAAGAATGCCAAGAACCCGGAAAATGC
ATTGGCGCATGGTCTTTTCCGGACCGTGCGGTCGGAGGCGGGCAAACTTGCTGCCACGTTGGATCTTGATCCTGA
TTCTCGACTGGACAACGACTCTCGATCCGAGCTGGTTCTTCAGGCACTGAAAAGTGTCCTGGCAGCTGGGGAGGA
GAGCTCGCCGTCTGATTTCGAATTTGCTGAAACGCAGGGAAAACTCGTCGTTCCTCGAGTCGTCGAGGATGGTCG
CATGAATGAAGTCATTCAGCGCTACACACGGCCAAACCTCCCGCATTTACAACCCTTCGACCAGGGCGACCGCCG
GCTGGAAATTGCCATCGGTATGCGTGGAGCCCTGGACTCCCTCTATTTCCGCGACCAGATTGTCGGTCCCCTCGG
CGATGATCAGGTGGAGATTAAGATCATCGCAACCGGCATGAACTTCAAGGACGTCGTCATTGCCATGGGCCAAGT
GAGCAGCTCGTACCTCGGTGTCGAGTGCAGTGGTATCATCTCGAAGGTGGGTAGCAAGGTGACCTCTCTATCCGT
CGGAGATCGAGTTTGCGCTATGTCGCTCGGCGCGTACGGCACTTTTGCAAGATGCAAGGCGACAAGCGCGGCTGT
TATTCCCGATAATATGTCGACAGAAGTTGCAGCATCGATCCCGGTCGTATACTCAACAGCATATTACGGCATGAT
CGAGCTCGCCCATCTTGAGCCGGGCGAGAGTATCCTAATCCACGCTGCCTCGGGTGGCGTTGGACAGGCCGCTAT
TCAACTGGCGAAGCTTATAGGAGCTGAGGTCTTCGCGACTGTTGGAAGCGCCGATAAAAAGATTCTGATCATGGA
AAAGTACGGCATTCCGGAGAACCGTATCTTCTACAGTCGCAATCCGGAGTTCGGCCCTGCTATTCGCGAGGCTAC
TGGCGGCCGAGGTGTCGATGTGGTCCTCAATTCTCTGGCCGGAGAGCTCTTGAGAGAATCCTGGGAGTGCCTGGC
GCATTTCGGCCGATTTATCGAGATTGGAAAGAGGGACATATCTTCGAACACGGGCCTAGGAATGGGCCAGTTCGA
ACATAACGTGACATTTAGCTCTGTCGACCTGACGCTTGTTGCCAAGGAGAGACCAAAGATCATGGGCCGCGTCCT
GAACTCGGTCATGGACCTGCTGAAGCAGAAGAAAATCTCCGCCATCGAGCCCATAACCGTCATGGGTATCTCAGA
GCTTGAGACGGCCTTGCGGACTCTTCAGGGCGGAAAGTCGACCGGTAAAATCGTGATCGCGCCCCGTGCTGGGGA
GCAGGTGAAGGTAATGCACCTTGCCTATTTTGCTCTGAAAATGCTTCTCGGCTAACTCGAAGTAACCAATAGGCA
ACGCACCGACATGCCACGAGTCTCTTGAAGCATAACGCAACCTACGTCATTATCGGCGGCACTGGCGGCTTAGGG
CGATCCATGGCCAAGCGGATGGTGGAGCGCGGCGCGAAACATATTGTGCTGTTGTCTCGAAATGGCCATATGACG
ACGGAACTGTCTAACCTGAGCAAAGACTGCCTTGCCCACGGGGCCACGATTGTCGTCAAGTCGTGCGATGTGACT
GATGAGGGCAGCGTCAAGCAGCTTATTGATGAGTGCGCCAAGACGCTGCCCCCTGTCCGTGGTATTGTCCACGCG
GCCATGGTCCTTAGGGTGAGGCCTCTTAAAAGTCACTATATGAGTTGGAGGAAATGCTGACTTCGGAATAGGATA
TGCTGTTTGAGAAGATGGCGTTTGAAGATTTCCAGAAAGTCGTTGAAGCCAAGGTTTCGGGTACTTGGCATTTCC
ACCGCGCTCTGAGTGAGCAGCAGCTCGACTTCTTCGTTGTTCTTTCCTCAGTTGCAGGCATTGTGGGCAACAGGG
GTCAAGCTGCATACGCAGCGGCAAATACTTTCCTCGACGCATTCGTTCAGCACAGGATACAGCAGGGCCTGCCAG
CAGCTTCCATTGACCTGACGGCGGTTGAAGGGGTCGGATACCTGGCAGAGAATGCCGCACGATCCAAGGAGGTAC
TGCAGAGTCTTTCCGGTACCACATTTGGCGAAGCGGAGGTTCTCGCACTCATCGAGGCGAGTTTCGACGGTCAGA
TCTCGAGGCTCTGCAACAGCCAGTGCATTACAGGCCTGAACTTTGAGGGCCAGTCGCTGCCGTACTATGCCGAGG
ATGCCAGGTTTTCCCACCTCCGCGACGCATTCCTGGAGAAAAACAAGATCTGCAATGCGCCAGGATCAGGGAGCC
AGGTGCCTTCTCAGGAAGAGGTCGCTCGTGCAGCCACGTACGACGAGGCTGTCGCGATTGTCACTCACAAAATGT
GGGACAAGCTCTGCGCTATCCTCATGCTGCCGCCCCAAGACACAGATCCTGACAGTACTGTGAAATCGTACGGCT
TGGACTCGTTGAACGCCATCGAGCTTCGAAACTGGATCGCCAAGGAATATCTTGCACATCTCCAGGTGCTCGAGC
TCCTGACATCGGGCACAATCCGAGACCTGGCAGGACTCGTCCTGAAGAAGACCAAAATCAAGCATGGATACAAAA
ACCCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail