Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5300
Gene name
LocationContig_2649:1471..2140
Strand-
Gene length (bp)669
Transcript length (bp)588
Coding sequence length (bp)588
Protein length (aa) 196

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B5BP49|YP55_SCHPO Uncharacterized transporter C460.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.05 PE=3 SV=1 6 195 1.0E-24
sp|O94491|YC7A_SCHPO Uncharacterized transporter C417.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.10 PE=3 SV=1 2 193 4.0E-18
sp|O74923|YJ7D_SCHPO Uncharacterized transporter C757.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC757.13 PE=3 SV=1 2 195 3.0E-16
sp|P15365|DAL5_YEAST Allantoate permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL5 PE=1 SV=1 2 193 2.0E-15
sp|O94572|YGDF_SCHPO Uncharacterized transporter C1773.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.15 PE=3 SV=1 51 193 6.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B5BP49|YP55_SCHPO Uncharacterized transporter C460.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.05 PE=3 SV=1 6 195 1.0E-24
sp|O94491|YC7A_SCHPO Uncharacterized transporter C417.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.10 PE=3 SV=1 2 193 4.0E-18
sp|O74923|YJ7D_SCHPO Uncharacterized transporter C757.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC757.13 PE=3 SV=1 2 195 3.0E-16
sp|P15365|DAL5_YEAST Allantoate permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL5 PE=1 SV=1 2 193 2.0E-15
sp|O94572|YGDF_SCHPO Uncharacterized transporter C1773.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.15 PE=3 SV=1 51 193 6.0E-15
sp|Q07904|THI73_YEAST Thiamine pathway transporter THI73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI73 PE=1 SV=1 2 195 7.0E-13
sp|Q9C0V8|YHJ1_SCHPO Uncharacterized transporter PB10D8.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB10D8.01 PE=3 SV=1 64 193 5.0E-08
sp|Q9C0U9|YQD3_SCHPO Uncharacterized transporter PB1C11.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCPB1C11.03 PE=1 SV=1 48 183 3.0E-07
sp|Q12235|YCT1_YEAST High affinity cysteine transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCT1 PE=1 SV=1 48 159 9.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.5

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 39 57 18
3 72 94 22
4 101 120 19
5 130 152 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5300
MGFGTFPTLLLQGGGAVVQLVLVLLCTGGSTYLRNTRTYFMAGNFALAIVGSVIIRQRPAHERWLRYAGYCLVLS
YSANFPMLMSMASGNVGGFTKKVTANAVSFTAYCVGNIIGPQLFTAKEAPSYTSGFLAMMVCFSVGLATCILLRL
YLQRENRARDRLHGAAPAAAALEGDTMVNLTDKTDKEILQFRYVY*
Coding >Hirsu2|5300
ATGGGCTTCGGCACCTTCCCGACGCTCCTCCTCCAGGGCGGCGGCGCCGTCGTCCAGCTGGTGCTCGTGCTGCTG
TGCACCGGCGGCAGCACCTATCTGCGCAACACGCGCACCTACTTCATGGCCGGCAACTTCGCCCTCGCCATCGTC
GGCTCCGTCATCATCCGCCAGCGGCCCGCCCACGAGCGCTGGCTGCGCTACGCCGGCTACTGCCTGGTGCTGTCC
TACAGCGCCAACTTCCCCATGCTCATGTCCATGGCCTCGGGCAACGTCGGCGGCTTCACCAAGAAGGTCACCGCC
AACGCAGTCTCTTTCACGGCCTACTGCGTCGGCAACATCATCGGCCCGCAGCTGTTCACGGCCAAGGAGGCGCCG
TCGTACACGTCGGGCTTCCTCGCCATGATGGTCTGCTTCAGCGTCGGTCTCGCCACCTGCATCCTCCTGCGCCTC
TACCTGCAGCGCGAGAACCGGGCCCGGGACCGCCTCCACGGCGCCGCTCCCGCCGCCGCCGCCCTCGAGGGCGAC
ACCATGGTCAACCTGACGGACAAGACGGACAAGGAGATTCTGCAGTTCCGGTACGTCTACTAG
Transcript >Hirsu2|5300
ATGGGCTTCGGCACCTTCCCGACGCTCCTCCTCCAGGGCGGCGGCGCCGTCGTCCAGCTGGTGCTCGTGCTGCTG
TGCACCGGCGGCAGCACCTATCTGCGCAACACGCGCACCTACTTCATGGCCGGCAACTTCGCCCTCGCCATCGTC
GGCTCCGTCATCATCCGCCAGCGGCCCGCCCACGAGCGCTGGCTGCGCTACGCCGGCTACTGCCTGGTGCTGTCC
TACAGCGCCAACTTCCCCATGCTCATGTCCATGGCCTCGGGCAACGTCGGCGGCTTCACCAAGAAGGTCACCGCC
AACGCAGTCTCTTTCACGGCCTACTGCGTCGGCAACATCATCGGCCCGCAGCTGTTCACGGCCAAGGAGGCGCCG
TCGTACACGTCGGGCTTCCTCGCCATGATGGTCTGCTTCAGCGTCGGTCTCGCCACCTGCATCCTCCTGCGCCTC
TACCTGCAGCGCGAGAACCGGGCCCGGGACCGCCTCCACGGCGCCGCTCCCGCCGCCGCCGCCCTCGAGGGCGAC
ACCATGGTCAACCTGACGGACAAGACGGACAAGGAGATTCTGCAGTTCCGGTACGTCTACTAG
Gene >Hirsu2|5300
ATGGGCTTCGGCACCTTCCCGACGCTCCTCCTCCAGGGCGGCGGCGCCGTCGTCCAGCTGGTGCTCGTGCTGCTG
TGCACCGGCGGCAGCACCTATCTGCGCAACACGCGCACCTACTTCATGGCCGGCAACTTCGCCCTCGCCATCGTC
GGCTCCGTCATCATCCGCCAGCGGCCCGCCCACGAGCGCTGGCTGCGCTACGCCGGCTACTGCCTGGTGCTGTCC
TACAGCGCCAACTTCCCCATGCTCATGTCCATGGCCTCGGGCAACGTCGGCGGCTTCACCAAGAAGGTCACCGCC
AACGCAGTCGTGAGTCCGTCCGACGATGCAGAGAGAGACACGAAAGCGTTGGTCCATGCCTCTAATACGAATAAA
AAAACAAAACACAAGTCTTTCACGGCCTACTGCGTCGGCAACATCATCGGCCCGCAGCTGTTCACGGCCAAGGAG
GCGCCGTCGTACACGTCGGGCTTCCTCGCCATGATGGTCTGCTTCAGCGTCGGTCTCGCCACCTGCATCCTCCTG
CGCCTCTACCTGCAGCGCGAGAACCGGGCCCGGGACCGCCTCCACGGCGCCGCTCCCGCCGCCGCCGCCCTCGAG
GGCGACACCATGGTCAACCTGACGGACAAGACGGACAAGGAGATTCTGCAGTTCCGGTACGTCTACTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail