Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|53
Gene name
LocationContig_1004:3311..5067
Strand+
Gene length (bp)1756
Transcript length (bp)1422
Coding sequence length (bp)1422
Protein length (aa) 474

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13621 Cupin_8 Cupin-like domain 1.4E-13 254 374
PF02373 JmjC JmjC domain, hydroxylase 6.2E-11 265 375
PF12937 F-box-like F-box-like 8.4E-08 35 80
PF00646 F-box F-box domain 1.1E-06 35 79

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q67XX3|FB252_ARATH F-box protein At5g06550 OS=Arabidopsis thaliana GN=At5g06550 PE=2 SV=1 8 426 4.0E-82
sp|Q9M9E8|FB92_ARATH F-box protein At1g78280 OS=Arabidopsis thaliana GN=At1g78280 PE=2 SV=3 31 376 3.0E-55
sp|Q6Q4H1|JMJD6_HYDVU Bifunctional arginine demethylase and lysyl-hydroxylase PSR OS=Hydra vulgaris GN=PSR PE=1 SV=1 143 375 4.0E-39
sp|Q5R6G2|JMJD6_PONAB Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 OS=Pongo abelii GN=JMJD6 PE=2 SV=1 150 376 1.0E-38
sp|Q6NYC1|JMJD6_HUMAN Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 OS=Homo sapiens GN=JMJD6 PE=1 SV=1 150 376 1.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q67XX3|FB252_ARATH F-box protein At5g06550 OS=Arabidopsis thaliana GN=At5g06550 PE=2 SV=1 8 426 4.0E-82
sp|Q9M9E8|FB92_ARATH F-box protein At1g78280 OS=Arabidopsis thaliana GN=At1g78280 PE=2 SV=3 31 376 3.0E-55
sp|Q6Q4H1|JMJD6_HYDVU Bifunctional arginine demethylase and lysyl-hydroxylase PSR OS=Hydra vulgaris GN=PSR PE=1 SV=1 143 375 4.0E-39
sp|Q5R6G2|JMJD6_PONAB Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 OS=Pongo abelii GN=JMJD6 PE=2 SV=1 150 376 1.0E-38
sp|Q6NYC1|JMJD6_HUMAN Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 OS=Homo sapiens GN=JMJD6 PE=1 SV=1 150 376 1.0E-38
sp|Q58DS6|JMJD6_BOVIN Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 OS=Bos taurus GN=JMJD6 PE=2 SV=1 105 376 2.0E-38
sp|Q5ZMK5|JMJD6_CHICK Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 OS=Gallus gallus GN=JMJD6 PE=2 SV=1 150 376 1.0E-37
sp|Q6AYK2|JMJD6_RAT Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 OS=Rattus norvegicus GN=Jmjd6 PE=2 SV=2 150 376 1.0E-37
sp|Q9ERI5|JMJD6_MOUSE Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 OS=Mus musculus GN=Jmjd6 PE=1 SV=2 150 376 1.0E-37
sp|Q6PFM0|JMJD6_DANRE Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 OS=Danio rerio GN=jmjd6 PE=2 SV=2 148 376 3.0E-37
sp|Q6GND3|JMD6A_XENLA Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6-A OS=Xenopus laevis GN=jmjd6-a PE=2 SV=1 151 379 4.0E-37
sp|Q7ZX37|JMD6B_XENLA Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6-B OS=Xenopus laevis GN=jmjd6-b PE=2 SV=1 150 379 7.0E-37
sp|Q9VD28|JMJD6_DROME Bifunctional arginine demethylase and lysyl-hydroxylase PSR OS=Drosophila melanogaster GN=PSR PE=2 SV=1 155 375 6.0E-35
sp|Q9GYI4|JMJD6_CAEEL Bifunctional arginine demethylase and lysyl-hydroxylase psr-1 OS=Caenorhabditis elegans GN=psr-1 PE=1 SV=2 149 375 9.0E-35
sp|Q623U2|JMJD6_CAEBR Bifunctional arginine demethylase and lysyl-hydroxylase psr-1 OS=Caenorhabditis briggsae GN=psr-1 PE=3 SV=1 123 375 1.0E-34
sp|Q9VJ97|JMJD4_DROME JmjC domain-containing protein 4 homolog OS=Drosophila melanogaster GN=CG7200 PE=2 SV=1 103 375 3.0E-11
sp|Q08BY5|JMJD4_DANRE JmjC domain-containing protein 4 OS=Danio rerio GN=jmjd4 PE=2 SV=1 263 408 7.0E-09
sp|Q5ZHV5|JMJD4_CHICK JmjC domain-containing protein 4 OS=Gallus gallus GN=JMJD4 PE=2 SV=1 263 376 1.0E-07
sp|Q8BFT6|JMJD4_MOUSE JmjC domain-containing protein 4 OS=Mus musculus GN=Jmjd4 PE=2 SV=1 263 376 3.0E-07
sp|Q5RHD1|KDM7A_DANRE Lysine-specific demethylase 7A OS=Danio rerio GN=kdm7a PE=2 SV=2 242 376 4.0E-07
sp|Q9H9V9|JMJD4_HUMAN JmjC domain-containing protein 4 OS=Homo sapiens GN=JMJD4 PE=1 SV=2 263 376 7.0E-07
sp|P0CF52|KDM7B_DANRE Lysine-specific demethylase 7B OS=Danio rerio GN=jhdm1db PE=2 SV=1 242 376 8.0E-07
sp|Q3UWM4|KDM7A_MOUSE Lysine-specific demethylase 7A OS=Mus musculus GN=Kdm7a PE=2 SV=2 242 376 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|53
MDGADSIPSHPLRVKPLGNRFLCSGPNARAGLGAWHALPDEVLMAVLEHSGQTDLLRLGSSCKFLYAFCHSDELW
KAICLQLPKERSHSLQWHGSWRRTVLGLPRDREACIDCGNVFSDVLHRPFACTNVNLAQYVAGIPKVNLMPRLDS
LTYDEFAERWTERPFILAKCIQEWPVCSLWTIDSLLRDYPDVEFRAEAVDWSLARYCRYMGENRDESPLYLFDRK
FADKMKITVGREAGAAYWRPDCFGPDLFEVLGEERPAHRWLIVGPERSGSTFHKDPNGTSAWNAVIQGAKYWIMF
PPTACVPGVYVSSDSSEVTSPLSIAEWLLTFHDEARRLPTCVEGVCRAGEMVHVPSGWWHLVVNLESGIALTQNF
VPLSPSLKLVSEVLSFLRDKADQVSGFSRAVEKPYELFVERLRQAYPDVLETALDMVDRKSGKKRKWDTAVGRNA
EAEGGAGFSFGFGCGDDDDDEIP*
Coding >Hirsu2|53
ATGGACGGCGCCGACTCGATCCCCTCGCATCCTCTCCGGGTCAAGCCCCTTGGAAACCGCTTCCTGTGCAGCGGC
CCCAACGCCCGGGCCGGCCTCGGCGCGTGGCATGCACTCCCAGACGAGGTGCTCATGGCCGTGCTGGAGCACTCC
GGCCAGACGGACCTCCTCCGCCTCGGCTCCTCATGCAAATTTCTCTACGCCTTTTGTCACTCGGACGAGCTGTGG
AAGGCTATATGTCTCCAGTTGCCAAAGGAGCGTAGCCACTCACTCCAATGGCATGGGTCTTGGAGACGCACCGTC
CTGGGCTTGCCGCGAGACCGAGAGGCCTGCATTGACTGCGGCAACGTCTTTTCCGACGTCCTGCACCGGCCCTTT
GCCTGCACCAATGTCAACCTGGCTCAGTACGTCGCCGGCATCCCCAAGGTAAACCTGATGCCACGCCTCGACAGC
CTCACCTACGATGAGTTCGCCGAGCGGTGGACAGAACGGCCGTTCATCCTGGCCAAGTGCATCCAGGAATGGCCC
GTCTGCTCCCTCTGGACCATCGACAGCCTGCTCCGGGACTACCCGGACGTCGAGTTCCGAGCCGAGGCCGTGGAT
TGGTCCCTTGCGCGATACTGCCGCTACATGGGCGAGAACAGGGACGAGAGCCCGCTGTACCTGTTTGACCGCAAG
TTTGCCGACAAGATGAAGATCACGGTCGGTCGCGAGGCCGGCGCAGCGTACTGGCGCCCCGATTGCTTCGGCCCA
GACCTGTTTGAGGTGTTGGGCGAGGAGCGGCCGGCCCATCGGTGGCTGATTGTCGGCCCCGAACGCAGCGGCTCG
ACCTTTCACAAAGACCCCAACGGCACGAGCGCCTGGAACGCCGTGATCCAGGGGGCCAAGTATTGGATCATGTTC
CCCCCGACAGCGTGCGTGCCGGGCGTCTACGTGTCGTCGGACAGCAGCGAGGTGACGAGTCCGCTGAGCATCGCC
GAGTGGCTGCTCACCTTCCACGACGAGGCACGCCGGCTGCCGACGTGTGTCGAAGGCGTCTGCCGCGCCGGGGAG
ATGGTCCACGTCCCGAGCGGGTGGTGGCACCTCGTGGTGAACCTGGAGAGCGGCATCGCCCTGACGCAGAATTTC
GTCCCCCTGTCGCCGAGCCTGAAGCTCGTCTCCGAGGTGCTCTCCTTTCTGCGGGACAAGGCGGACCAAGTGTCG
GGCTTCTCGCGCGCGGTCGAGAAGCCGTACGAGCTCTTCGTCGAGAGACTACGGCAAGCGTACCCGGACGTCCTC
GAGACGGCCCTGGACATGGTGGACAGGAAGAGCGGCAAGAAGCGCAAGTGGGACACGGCGGTCGGGCGAAACGCA
GAGGCGGAGGGAGGCGCAGGCTTCAGTTTCGGGTTCGGCTGCGGCGACGACGACGACGACGAAATACCGTGA
Transcript >Hirsu2|53
ATGGACGGCGCCGACTCGATCCCCTCGCATCCTCTCCGGGTCAAGCCCCTTGGAAACCGCTTCCTGTGCAGCGGC
CCCAACGCCCGGGCCGGCCTCGGCGCGTGGCATGCACTCCCAGACGAGGTGCTCATGGCCGTGCTGGAGCACTCC
GGCCAGACGGACCTCCTCCGCCTCGGCTCCTCATGCAAATTTCTCTACGCCTTTTGTCACTCGGACGAGCTGTGG
AAGGCTATATGTCTCCAGTTGCCAAAGGAGCGTAGCCACTCACTCCAATGGCATGGGTCTTGGAGACGCACCGTC
CTGGGCTTGCCGCGAGACCGAGAGGCCTGCATTGACTGCGGCAACGTCTTTTCCGACGTCCTGCACCGGCCCTTT
GCCTGCACCAATGTCAACCTGGCTCAGTACGTCGCCGGCATCCCCAAGGTAAACCTGATGCCACGCCTCGACAGC
CTCACCTACGATGAGTTCGCCGAGCGGTGGACAGAACGGCCGTTCATCCTGGCCAAGTGCATCCAGGAATGGCCC
GTCTGCTCCCTCTGGACCATCGACAGCCTGCTCCGGGACTACCCGGACGTCGAGTTCCGAGCCGAGGCCGTGGAT
TGGTCCCTTGCGCGATACTGCCGCTACATGGGCGAGAACAGGGACGAGAGCCCGCTGTACCTGTTTGACCGCAAG
TTTGCCGACAAGATGAAGATCACGGTCGGTCGCGAGGCCGGCGCAGCGTACTGGCGCCCCGATTGCTTCGGCCCA
GACCTGTTTGAGGTGTTGGGCGAGGAGCGGCCGGCCCATCGGTGGCTGATTGTCGGCCCCGAACGCAGCGGCTCG
ACCTTTCACAAAGACCCCAACGGCACGAGCGCCTGGAACGCCGTGATCCAGGGGGCCAAGTATTGGATCATGTTC
CCCCCGACAGCGTGCGTGCCGGGCGTCTACGTGTCGTCGGACAGCAGCGAGGTGACGAGTCCGCTGAGCATCGCC
GAGTGGCTGCTCACCTTCCACGACGAGGCACGCCGGCTGCCGACGTGTGTCGAAGGCGTCTGCCGCGCCGGGGAG
ATGGTCCACGTCCCGAGCGGGTGGTGGCACCTCGTGGTGAACCTGGAGAGCGGCATCGCCCTGACGCAGAATTTC
GTCCCCCTGTCGCCGAGCCTGAAGCTCGTCTCCGAGGTGCTCTCCTTTCTGCGGGACAAGGCGGACCAAGTGTCG
GGCTTCTCGCGCGCGGTCGAGAAGCCGTACGAGCTCTTCGTCGAGAGACTACGGCAAGCGTACCCGGACGTCCTC
GAGACGGCCCTGGACATGGTGGACAGGAAGAGCGGCAAGAAGCGCAAGTGGGACACGGCGGTCGGGCGAAACGCA
GAGGCGGAGGGAGGCGCAGGCTTCAGTTTCGGGTTCGGCTGCGGCGACGACGACGACGACGAAATACCGTGA
Gene >Hirsu2|53
ATGGACGGCGCCGACTCGATCCCCTCGCATCCTCTCCGGGTCAAGCCCCTTGGAAACCGCTTCCTGTGCAGCGGC
CCCAACGCCCGGGCCGGCCTCGGCGCGTGGCATGCACTCCCAGACGAGGTGCTCATGGCCGTGCTGGAGCACTCC
GGCCAGACGGACCTCCTCCGCCTCGGCTCCTCATGCAAATTTCTCTACGCCTTTTGTCACTCGGACGAGCTGTGG
AAGGCTATATGTCTCCAGTGAGTTCTCTCTGCTCGTGCCATCCGCCGCTCCGTCTTCATCCGCCGCTCTGCGTCG
ACCCTAAGGCCCGCCTCCTGTCTGGAGCAGACAGTCCAGCGGGGACAGCACGACGAGGCAGGGTCAGGCCGCTCG
CTGGCTGGACAAGGTCATCCGCGCGAGGAATCGTGATGCCCGTCGCCCTTGTTGCGGGCGGCTCTAGTAGACGAG
CTTCCACCGCTTCGGCGATACTCGTACTTGTGGCTTTCCCCTGCAGCAACCGCTCCTCATTTTGTCCTAACGCTC
GCAAGCTCCCCCCCCTGTATGGCCTCGCGTGACTGACTGGGCACCAATCAGGTTGCCAAAGGAGCGTAGCCACTC
ACTCCAATGGCATGGGTCTTGGAGACGCACCGTCCTGGGCTTGCCGCGAGACCGAGAGGCCTGCATTGACTGCGG
CAACGTCTTTTCCGACGTCCTGCACCGGCCCTTTGCCTGCACCAATGTCAACCTGGCTCAGTACGTCGCCGGCAT
CCCCAAGGTAAACCTGATGCCACGCCTCGACAGCCTCACCTACGATGAGTTCGCCGAGCGGTGGACAGAACGGCC
GTTCATCCTGGCCAAGTGCATCCAGGAATGGCCCGTCTGCTCCCTCTGGACCATCGACAGCCTGCTCCGGGACTA
CCCGGACGTCGAGTTCCGAGCCGAGGCCGTGGATTGGTCCCTTGCGCGATACTGCCGCTACATGGGCGAGAACAG
GGACGAGAGCCCGCTGTACCTGTTTGACCGCAAGTTTGCCGACAAGATGAAGATCACGGTCGGTCGCGAGGCCGG
CGCAGCGTACTGGCGCCCCGATTGCTTCGGCCCAGACCTGTTTGAGGTGTTGGGCGAGGAGCGGCCGGCCCATCG
GTGGCTGATTGTCGGCCCCGAACGCAGCGGCTCGACCTTTCACAAAGACCCCAACGGCACGAGCGCCTGGAACGC
CGTGATCCAGGGGGCCAAGTATTGGATCATGTTCCCCCCGACAGCGTGCGTGCCGGGCGTCTACGTGTCGTCGGA
CAGCAGCGAGGTGACGAGTCCGCTGAGCATCGCCGAGTGGCTGCTCACCTTCCACGACGAGGCACGCCGGCTGCC
GACGTGTGTCGAAGGCGTCTGCCGCGCCGGGGAGATGGTCCACGTCCCGAGCGGGTGGTGGCACCTCGTGGTGAA
CCTGGAGAGCGGCATCGCCCTGACGCAGAATTTCGTCCCCCTGTCGCCGAGCCTGAAGCTCGTCTCCGAGGTGCT
CTCCTTTCTGCGGGACAAGGCGGACCAAGTGTCGGGCTTCTCGCGCGCGGTCGAGAAGCCGTACGAGCTCTTCGT
CGAGAGACTACGGCAAGCGTACCCGGACGTCCTCGAGACGGCCCTGGACATGGTGGACAGGAAGAGCGGCAAGAA
GCGCAAGTGGGACACGGCGGTCGGGCGAAACGCAGAGGCGGAGGGAGGCGCAGGCTTCAGTTTCGGGTTCGGCTG
CGGCGACGACGACGACGACGAAATACCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail