Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5297
Gene name
LocationContig_2648:167..2047
Strand+
Gene length (bp)1880
Transcript length (bp)1809
Coding sequence length (bp)1809
Protein length (aa) 603

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04768 NAT NAT, N-acetyltransferase, of N-acetylglutamate synthase 2.5E-47 402 576

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q1K8F6|NAGS_NEUCR Amino-acid acetyltransferase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=arg-14 PE=1 SV=2 20 601 5.0E-154
sp|B2B2C5|NAGS_PODAN Amino-acid acetyltransferase, mitochondrial OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=ARG2 PE=3 SV=1 15 601 1.0E-151
sp|B8NG97|NAGS_ASPFN Amino-acid acetyltransferase, mitochondrial OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=arg2 PE=3 SV=1 19 601 2.0E-135
sp|A4RKF7|NAGS_MAGO7 Amino-acid acetyltransferase, mitochondrial OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ARG2 PE=3 SV=2 15 601 4.0E-135
sp|Q2UES9|NAGS_ASPOR Amino-acid acetyltransferase, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=arg2 PE=3 SV=1 20 601 1.0E-134
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q1K8F6|NAGS_NEUCR Amino-acid acetyltransferase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=arg-14 PE=1 SV=2 20 601 5.0E-154
sp|B2B2C5|NAGS_PODAN Amino-acid acetyltransferase, mitochondrial OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=ARG2 PE=3 SV=1 15 601 1.0E-151
sp|B8NG97|NAGS_ASPFN Amino-acid acetyltransferase, mitochondrial OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=arg2 PE=3 SV=1 19 601 2.0E-135
sp|A4RKF7|NAGS_MAGO7 Amino-acid acetyltransferase, mitochondrial OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ARG2 PE=3 SV=2 15 601 4.0E-135
sp|Q2UES9|NAGS_ASPOR Amino-acid acetyltransferase, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=arg2 PE=3 SV=1 20 601 1.0E-134
sp|Q4X122|NAGS_ASPFU Amino-acid acetyltransferase, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=arg2 PE=3 SV=2 14 601 1.0E-131
sp|B0XSH8|NAGS_ASPFC Amino-acid acetyltransferase, mitochondrial OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=arg2 PE=3 SV=1 14 601 1.0E-131
sp|A6SG85|NAGS_BOTFB Amino-acid acetyltransferase, mitochondrial OS=Botryotinia fuckeliana (strain B05.10) GN=arg2 PE=3 SV=1 18 601 5.0E-128
sp|A1DH62|NAGS_NEOFI Amino-acid acetyltransferase, mitochondrial OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=arg2 PE=3 SV=1 19 601 8.0E-127
sp|A2QGF0|NAGS_ASPNC Amino-acid acetyltransferase, mitochondrial OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=arg2 PE=3 SV=1 19 601 3.0E-124
sp|Q1DNE1|NAGS_COCIM Amino-acid acetyltransferase, mitochondrial OS=Coccidioides immitis (strain RS) GN=ARG2 PE=3 SV=1 7 601 5.0E-124
sp|B6H6F3|NAGS_PENRW Amino-acid acetyltransferase, mitochondrial OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=arg2 PE=3 SV=1 19 601 2.0E-123
sp|A6RBX7|NAGS_AJECN Amino-acid acetyltransferase, mitochondrial OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=ARG2 PE=3 SV=1 22 601 2.0E-122
sp|B8M3T8|NAGS_TALSN Amino-acid acetyltransferase, mitochondrial OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=arg2 PE=3 SV=1 14 601 3.0E-122
sp|Q0CY06|NAGS_ASPTN Amino-acid acetyltransferase, mitochondrial OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=arg2 PE=3 SV=1 14 601 3.0E-122
sp|A7F8R0|NAGS_SCLS1 Amino-acid acetyltransferase, mitochondrial OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=arg2 PE=3 SV=1 18 593 5.0E-122
sp|A1C6J2|NAGS_ASPCL Amino-acid acetyltransferase, mitochondrial OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=arg2 PE=3 SV=1 14 601 3.0E-121
sp|B6QS64|NAGS_TALMQ Amino-acid acetyltransferase, mitochondrial OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=arg2 PE=3 SV=1 14 601 1.0E-120
sp|Q5B0R3|NAGS_EMENI Amino-acid acetyltransferase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=arg2 PE=3 SV=2 19 601 2.0E-120
sp|B2WME0|NAGS_PYRTR Amino-acid acetyltransferase, mitochondrial OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=arg2 PE=3 SV=1 20 601 1.0E-88
sp|Q0U6Q5|NAGS_PHANO Amino-acid acetyltransferase, mitochondrial OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=ARG2 PE=3 SV=1 76 601 2.0E-87
sp|Q6CEE1|NAGS_YARLI Amino-acid acetyltransferase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ARG2 PE=3 SV=1 21 598 6.0E-78
sp|O94330|NAGS_SCHPO Amino-acid acetyltransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arg6 PE=3 SV=1 14 601 1.0E-59
sp|B6JWC1|NAGS_SCHJY Amino-acid acetyltransferase, mitochondrial OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=arg2 PE=3 SV=1 22 599 5.0E-58
sp|B9W7S3|NAGS_CANDC Amino-acid acetyltransferase, mitochondrial OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=ARG2 PE=3 SV=1 20 599 6.0E-58
sp|Q6BZ43|NAGS_DEBHA Amino-acid acetyltransferase, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ARG2 PE=3 SV=2 20 599 8.0E-58
sp|A5DWN5|NAGS_LODEL Amino-acid acetyltransferase, mitochondrial OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=ARG2 PE=3 SV=1 20 574 3.0E-55
sp|A5DA88|NAGS_PICGU Amino-acid acetyltransferase, mitochondrial OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=ARG2 PE=3 SV=2 4 600 4.0E-55
sp|Q59MB6|NAGS_CANAL Amino-acid acetyltransferase, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ARG2 PE=2 SV=1 20 599 2.0E-54
sp|A3GG03|NAGS_PICST Amino-acid acetyltransferase, mitochondrial OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ARG2 PE=3 SV=2 20 599 4.0E-52
sp|Q595W7|NAGS_PICPA Amino-acid acetyltransferase, mitochondrial OS=Komagataella pastoris GN=ARG2 PE=3 SV=1 1 599 3.0E-51
sp|Q6CRT7|NAGS_KLULA Amino-acid acetyltransferase, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ARG2 PE=3 SV=1 21 599 2.0E-50
sp|A7TQL5|NAGS_VANPO Amino-acid acetyltransferase, mitochondrial OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=ARG2 PE=3 SV=1 18 599 9.0E-48
sp|Q6FS75|NAGS_CANGA Amino-acid acetyltransferase, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ARG2 PE=3 SV=1 246 600 3.0E-42
sp|P40360|NAGS_YEAST Amino-acid acetyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARG2 PE=1 SV=1 242 601 1.0E-40
sp|B3LQ40|NAGS_YEAS1 Amino-acid acetyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain RM11-1a) GN=ARG2 PE=3 SV=1 242 601 1.0E-40
sp|A6ZPQ2|NAGS_YEAS7 Amino-acid acetyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain YJM789) GN=ARG2 PE=3 SV=1 242 601 1.0E-40
sp|Q75A07|NAGS_ASHGO Amino-acid acetyltransferase, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ARG2 PE=3 SV=1 245 600 2.0E-39
sp|P0CM19|NAGS_CRYNB Amino-acid acetyltransferase, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ARG2 PE=3 SV=1 24 573 2.0E-34
sp|P0CM18|NAGS_CRYNJ Amino-acid acetyltransferase, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ARG2 PE=3 SV=1 24 573 3.0E-34
sp|A8N2M6|NAGS_COPC7 Amino-acid acetyltransferase, mitochondrial OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=ARG2 PE=3 SV=1 247 573 1.0E-31
sp|B0CR45|NAGS_LACBS Amino-acid acetyltransferase, mitochondrial OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=ARG2 PE=3 SV=1 247 599 3.0E-31
sp|Q8R4H7|NAGS_MOUSE N-acetylglutamate synthase, mitochondrial OS=Mus musculus GN=Nags PE=1 SV=2 433 577 3.0E-14
sp|Q8N159|NAGS_HUMAN N-acetylglutamate synthase, mitochondrial OS=Homo sapiens GN=NAGS PE=1 SV=1 441 577 1.0E-13
sp|Q8P8J6|ARGB_XANCP Acetylglutamate kinase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=argB PE=3 SV=2 441 576 1.0E-11
sp|Q9PEM7|ARGB_XYLFA Acetylglutamate kinase OS=Xylella fastidiosa (strain 9a5c) GN=argB PE=3 SV=2 441 580 4.0E-10
sp|Q87EL2|ARGB_XYLFT Acetylglutamate kinase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=argB PE=1 SV=1 441 580 4.0E-10
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5297
MTTRCLPQTLVVGVRKLALERDVIVSVLESTATRREAKGYLQKYAKKKPLSKLEQDATQLVPRTQLRDDVLSDKE
PINVAIVKLRAPQLLTYNVISGIANTLLQLRVLGLLAIVVVDCGVNASRQVFEREAFRLCEAIDSILGHQGARVA
GNLFAARHSQRNDVPTAIFSRSMCVDDAGLLDRALQHGMIVIAPSLTRRDDLSTPQPAGAHETILTLLKYLSGMQ
FEILNHGDTYPGLPRKIASVERLILLDPLGGIPLPGRPSLRHRFINLEQEFGQLRHHMQASRPTPMTQAEAVTKP
GTIHAENLKLVKDGLSLLPPSSSALITTPVAAANSRPLSPSSSAPTIGRKPFNLTEMVTTRKHRNPLLHNLLTDR
PVSSPSLPLQRIRGGDASGDLRLEDLHATTLVKRGLPVTIYPDPKFTAWQPPKPDSPRLRLTDICIDLPRLVRLI
EDSFHRKLDVQAYIDRVNDNLAGIIIAGEYEGCAILTWEPVSFAYKPANRAARFVPYLDKFAVMRNHQGSGGVAD
IVFNAMVQDCLPEGVCWRSRNENPVNKWYFERSTGTSKLSKSNWTMFWTTLGLGHKNSKLRDYEWVCRNIPASWA
DF*
Coding >Hirsu2|5297
ATGACTACTCGATGTTTGCCCCAAACTTTAGTCGTGGGTGTGAGAAAGCTGGCTTTGGAACGGGACGTCATTGTA
TCTGTGCTCGAGTCTACGGCAACTAGACGCGAAGCAAAGGGTTATCTCCAAAAGTACGCAAAGAAAAAACCATTG
TCAAAGCTGGAGCAAGATGCAACCCAGTTGGTTCCACGAACGCAGCTACGTGATGACGTTCTGTCCGATAAGGAA
CCCATCAATGTAGCTATCGTGAAGTTACGCGCGCCACAGCTTCTCACGTACAACGTTATCAGTGGTATTGCGAAC
ACCCTTTTGCAACTTCGCGTCCTGGGCCTCCTAGCTATTGTTGTCGTCGACTGTGGCGTTAATGCCAGCCGTCAA
GTCTTCGAGCGCGAAGCGTTTCGCCTATGCGAAGCTATTGATTCGATCCTCGGCCACCAGGGGGCAAGGGTGGCT
GGTAATCTATTTGCCGCGCGTCACTCCCAAAGAAATGACGTCCCAACAGCTATCTTCTCAAGGTCTATGTGTGTG
GATGATGCAGGTCTCCTTGACCGGGCGCTTCAACATGGCATGATAGTGATAGCCCCGTCCCTAACTCGCCGCGAC
GATCTATCGACCCCGCAACCTGCTGGAGCGCACGAGACGATACTGACGCTACTGAAATACCTCAGTGGCATGCAA
TTTGAAATTTTGAACCATGGCGACACTTACCCCGGCCTGCCTAGAAAAATCGCATCAGTTGAGAGATTGATACTT
TTGGATCCGTTGGGAGGAATTCCGCTGCCGGGCAGACCTAGCCTACGTCACCGGTTCATTAACTTGGAGCAGGAA
TTCGGCCAGTTGAGGCATCATATGCAGGCATCCCGGCCGACTCCCATGACGCAAGCCGAAGCCGTGACTAAACCA
GGAACGATACATGCGGAAAATTTGAAACTCGTCAAAGATGGGCTCTCGTTGCTGCCACCCTCATCGTCGGCCCTC
ATCACGACCCCCGTCGCTGCAGCGAACAGTCGTCCATTGTCACCCTCCTCATCGGCCCCTACAATTGGCCGTAAG
CCTTTCAACTTGACTGAGATGGTGACCACCAGAAAGCATCGCAACCCACTTCTACACAATCTTCTCACCGACAGA
CCCGTGTCTTCGCCGTCTCTGCCGCTCCAGCGAATCCGGGGCGGCGATGCCTCTGGCGACCTGCGACTGGAGGAC
TTGCACGCCACGACCCTGGTCAAGCGCGGGTTGCCGGTCACAATATACCCTGATCCTAAATTCACAGCGTGGCAG
CCTCCCAAGCCGGACTCGCCCCGTCTTCGCCTGACTGATATCTGTATCGACCTTCCGCGATTGGTTCGACTGATA
GAAGATTCCTTTCACCGTAAACTTGACGTTCAGGCTTACATTGACCGTGTCAACGATAACCTGGCCGGTATCATA
ATCGCTGGAGAGTACGAGGGCTGCGCGATCTTGACATGGGAACCGGTATCATTCGCTTATAAGCCTGCCAACAGA
GCCGCGCGCTTCGTCCCCTATCTGGATAAATTTGCGGTCATGAGAAACCACCAGGGAAGTGGTGGCGTGGCGGAC
ATTGTGTTTAACGCCATGGTACAAGATTGTCTACCGGAAGGCGTATGCTGGAGGAGTCGAAACGAAAACCCGGTG
AACAAATGGTACTTCGAGCGCTCGACTGGAACAAGCAAACTGTCCAAGTCTAATTGGACCATGTTTTGGACCACG
CTGGGGCTCGGCCACAAGAACAGCAAGCTGCGGGATTATGAATGGGTATGTCGAAATATCCCCGCATCTTGGGCA
GATTTCTAG
Transcript >Hirsu2|5297
ATGACTACTCGATGTTTGCCCCAAACTTTAGTCGTGGGTGTGAGAAAGCTGGCTTTGGAACGGGACGTCATTGTA
TCTGTGCTCGAGTCTACGGCAACTAGACGCGAAGCAAAGGGTTATCTCCAAAAGTACGCAAAGAAAAAACCATTG
TCAAAGCTGGAGCAAGATGCAACCCAGTTGGTTCCACGAACGCAGCTACGTGATGACGTTCTGTCCGATAAGGAA
CCCATCAATGTAGCTATCGTGAAGTTACGCGCGCCACAGCTTCTCACGTACAACGTTATCAGTGGTATTGCGAAC
ACCCTTTTGCAACTTCGCGTCCTGGGCCTCCTAGCTATTGTTGTCGTCGACTGTGGCGTTAATGCCAGCCGTCAA
GTCTTCGAGCGCGAAGCGTTTCGCCTATGCGAAGCTATTGATTCGATCCTCGGCCACCAGGGGGCAAGGGTGGCT
GGTAATCTATTTGCCGCGCGTCACTCCCAAAGAAATGACGTCCCAACAGCTATCTTCTCAAGGTCTATGTGTGTG
GATGATGCAGGTCTCCTTGACCGGGCGCTTCAACATGGCATGATAGTGATAGCCCCGTCCCTAACTCGCCGCGAC
GATCTATCGACCCCGCAACCTGCTGGAGCGCACGAGACGATACTGACGCTACTGAAATACCTCAGTGGCATGCAA
TTTGAAATTTTGAACCATGGCGACACTTACCCCGGCCTGCCTAGAAAAATCGCATCAGTTGAGAGATTGATACTT
TTGGATCCGTTGGGAGGAATTCCGCTGCCGGGCAGACCTAGCCTACGTCACCGGTTCATTAACTTGGAGCAGGAA
TTCGGCCAGTTGAGGCATCATATGCAGGCATCCCGGCCGACTCCCATGACGCAAGCCGAAGCCGTGACTAAACCA
GGAACGATACATGCGGAAAATTTGAAACTCGTCAAAGATGGGCTCTCGTTGCTGCCACCCTCATCGTCGGCCCTC
ATCACGACCCCCGTCGCTGCAGCGAACAGTCGTCCATTGTCACCCTCCTCATCGGCCCCTACAATTGGCCGTAAG
CCTTTCAACTTGACTGAGATGGTGACCACCAGAAAGCATCGCAACCCACTTCTACACAATCTTCTCACCGACAGA
CCCGTGTCTTCGCCGTCTCTGCCGCTCCAGCGAATCCGGGGCGGCGATGCCTCTGGCGACCTGCGACTGGAGGAC
TTGCACGCCACGACCCTGGTCAAGCGCGGGTTGCCGGTCACAATATACCCTGATCCTAAATTCACAGCGTGGCAG
CCTCCCAAGCCGGACTCGCCCCGTCTTCGCCTGACTGATATCTGTATCGACCTTCCGCGATTGGTTCGACTGATA
GAAGATTCCTTTCACCGTAAACTTGACGTTCAGGCTTACATTGACCGTGTCAACGATAACCTGGCCGGTATCATA
ATCGCTGGAGAGTACGAGGGCTGCGCGATCTTGACATGGGAACCGGTATCATTCGCTTATAAGCCTGCCAACAGA
GCCGCGCGCTTCGTCCCCTATCTGGATAAATTTGCGGTCATGAGAAACCACCAGGGAAGTGGTGGCGTGGCGGAC
ATTGTGTTTAACGCCATGGTACAAGATTGTCTACCGGAAGGCGTATGCTGGAGGAGTCGAAACGAAAACCCGGTG
AACAAATGGTACTTCGAGCGCTCGACTGGAACAAGCAAACTGTCCAAGTCTAATTGGACCATGTTTTGGACCACG
CTGGGGCTCGGCCACAAGAACAGCAAGCTGCGGGATTATGAATGGGTATGTCGAAATATCCCCGCATCTTGGGCA
GATTTCTAG
Gene >Hirsu2|5297
ATGACTACTCGATGTTTGCCCCAAACTTTAGTCGTGGGTGTGAGAAAGCTGGCTTTGGAACGGGTGAGTGTGAAG
CACAAATTAATGAGTCATGGCTAGTTTGTATGAACCACCGTCCTTGACCACGGATCCAGGACGTCATTGTATCTG
TGCTCGAGTCTACGGCAACTAGACGCGAAGCAAAGGGTTATCTCCAAAAGTACGCAAAGAAAAAACCATTGTCAA
AGCTGGAGCAAGATGCAACCCAGTTGGTTCCACGAACGCAGCTACGTGATGACGTTCTGTCCGATAAGGAACCCA
TCAATGTAGCTATCGTGAAGTTACGCGCGCCACAGCTTCTCACGTACAACGTTATCAGTGGTATTGCGAACACCC
TTTTGCAACTTCGCGTCCTGGGCCTCCTAGCTATTGTTGTCGTCGACTGTGGCGTTAATGCCAGCCGTCAAGTCT
TCGAGCGCGAAGCGTTTCGCCTATGCGAAGCTATTGATTCGATCCTCGGCCACCAGGGGGCAAGGGTGGCTGGTA
ATCTATTTGCCGCGCGTCACTCCCAAAGAAATGACGTCCCAACAGCTATCTTCTCAAGGTCTATGTGTGTGGATG
ATGCAGGTCTCCTTGACCGGGCGCTTCAACATGGCATGATAGTGATAGCCCCGTCCCTAACTCGCCGCGACGATC
TATCGACCCCGCAACCTGCTGGAGCGCACGAGACGATACTGACGCTACTGAAATACCTCAGTGGCATGCAATTTG
AAATTTTGAACCATGGCGACACTTACCCCGGCCTGCCTAGAAAAATCGCATCAGTTGAGAGATTGATACTTTTGG
ATCCGTTGGGAGGAATTCCGCTGCCGGGCAGACCTAGCCTACGTCACCGGTTCATTAACTTGGAGCAGGAATTCG
GCCAGTTGAGGCATCATATGCAGGCATCCCGGCCGACTCCCATGACGCAAGCCGAAGCCGTGACTAAACCAGGAA
CGATACATGCGGAAAATTTGAAACTCGTCAAAGATGGGCTCTCGTTGCTGCCACCCTCATCGTCGGCCCTCATCA
CGACCCCCGTCGCTGCAGCGAACAGTCGTCCATTGTCACCCTCCTCATCGGCCCCTACAATTGGCCGTAAGCCTT
TCAACTTGACTGAGATGGTGACCACCAGAAAGCATCGCAACCCACTTCTACACAATCTTCTCACCGACAGACCCG
TGTCTTCGCCGTCTCTGCCGCTCCAGCGAATCCGGGGCGGCGATGCCTCTGGCGACCTGCGACTGGAGGACTTGC
ACGCCACGACCCTGGTCAAGCGCGGGTTGCCGGTCACAATATACCCTGATCCTAAATTCACAGCGTGGCAGCCTC
CCAAGCCGGACTCGCCCCGTCTTCGCCTGACTGATATCTGTATCGACCTTCCGCGATTGGTTCGACTGATAGAAG
ATTCCTTTCACCGTAAACTTGACGTTCAGGCTTACATTGACCGTGTCAACGATAACCTGGCCGGTATCATAATCG
CTGGAGAGTACGAGGGCTGCGCGATCTTGACATGGGAACCGGTATCATTCGCTTATAAGCCTGCCAACAGAGCCG
CGCGCTTCGTCCCCTATCTGGATAAATTTGCGGTCATGAGAAACCACCAGGGAAGTGGTGGCGTGGCGGACATTG
TGTTTAACGCCATGGTACAAGATTGTCTACCGGAAGGCGTATGCTGGAGGAGTCGAAACGAAAACCCGGTGAACA
AATGGTACTTCGAGCGCTCGACTGGAACAAGCAAACTGTCCAAGTCTAATTGGACCATGTTTTGGACCACGCTGG
GGCTCGGCCACAAGAACAGCAAGCTGCGGGATTATGAATGGGTATGTCGAAATATCCCCGCATCTTGGGCAGATT
TCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail