Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5275
Gene name
LocationContig_263:23898..25908
Strand-
Gene length (bp)2010
Transcript length (bp)2010
Coding sequence length (bp)2010
Protein length (aa) 670

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05794 Tcp11 T-complex protein 11 4.6E-108 133 653

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40317|SOK1_YEAST Protein SOK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SOK1 PE=1 SV=2 112 414 3.0E-54
sp|Q9NUJ3|T11L1_HUMAN T-complex protein 11-like protein 1 OS=Homo sapiens GN=TCP11L1 PE=1 SV=1 80 346 3.0E-13
sp|Q01755|TCP11_MOUSE T-complex protein 11 OS=Mus musculus GN=Tcp11 PE=1 SV=1 153 346 1.0E-12
sp|Q5XI00|TCP11_RAT T-complex protein 11 homolog OS=Rattus norvegicus GN=Tcp11 PE=1 SV=1 135 346 1.0E-12
sp|Q8WWU5|TCP11_HUMAN T-complex protein 11 homolog OS=Homo sapiens GN=TCP11 PE=2 SV=1 153 398 9.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40317|SOK1_YEAST Protein SOK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SOK1 PE=1 SV=2 112 414 3.0E-54
sp|Q9NUJ3|T11L1_HUMAN T-complex protein 11-like protein 1 OS=Homo sapiens GN=TCP11L1 PE=1 SV=1 80 346 3.0E-13
sp|Q01755|TCP11_MOUSE T-complex protein 11 OS=Mus musculus GN=Tcp11 PE=1 SV=1 153 346 1.0E-12
sp|Q5XI00|TCP11_RAT T-complex protein 11 homolog OS=Rattus norvegicus GN=Tcp11 PE=1 SV=1 135 346 1.0E-12
sp|Q8WWU5|TCP11_HUMAN T-complex protein 11 homolog OS=Homo sapiens GN=TCP11 PE=2 SV=1 153 398 9.0E-12
sp|B4DZS4|T11X1_HUMAN T-complex protein 11 X-linked protein 1 OS=Homo sapiens GN=TCP11X1 PE=2 SV=1 118 342 2.0E-11
sp|Q8BTG3|T11L1_MOUSE T-complex protein 11-like protein 1 OS=Mus musculus GN=Tcp11l1 PE=1 SV=1 109 346 2.0E-10
sp|Q8N4U5|T11L2_HUMAN T-complex protein 11-like protein 2 OS=Homo sapiens GN=TCP11L2 PE=2 SV=1 128 421 8.0E-10
sp|A7Z033|T11L2_BOVIN T-complex protein 11-like protein 2 OS=Bos taurus GN=TCP11L2 PE=2 SV=1 128 421 5.0E-09
sp|Q5H9J9|T11X2_HUMAN T-complex protein 11 X-linked protein 2 OS=Homo sapiens GN=TCP11X2 PE=3 SV=1 162 394 5.0E-08
sp|Q8K1H7|T11L2_MOUSE T-complex protein 11-like protein 2 OS=Mus musculus GN=Tcp11l2 PE=1 SV=1 125 427 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5275
MEQGFGGGPVERSRRSLSTSAPVSNPEGESMKDPDVQMQQPPQNETEKKVISSPSQESPRRCEAAVRASSPASAA
LSRTASNSTQPGTPVADTAPNRKHSRHAAAHAWPAEPPVTRSTLSELDVSKIIHNPKLRHDINFDPELHFRPNLD
GEKGRKKQDRANQFWKTLKEELTDFLTDRAAFVHKHAARNDWTLPALLKAVKEIIQTLVPQRDRQFLDEGLNVEL
LMQQFYKGVADLEKLALWLSRVLKSHCAPMRDDWVDTMYSQLSSGNRNADLDELVTGMRSLLSVLEAMKLDVANH
QIRCLRPVLIEDTTHFEQKFFLRKMQSNKVDTSGARRWYVDADRRLSPALGNTSHTFGEMGVFFEALTHLVLPST
AEKRVPSTFLFDEERILKLRSDMLDAINLEVCMRMYDDLDRVGRLSSRMFGASRALDEDALNRSVSPSCEFNFNT
PLSTSRPSSLALSSAGSASSSPRSSLVMPSYVAPESGEDRARSRTVFNTLVALLQSAAPTSRPYVRWQEIAPSMA
LQIFRYTNAPSEMLPAFEEKLTENVCHASSQLYLEVEQAFHSKLMTELGCRVREFKVLSGVSLFAVATGGRVQSG
SGSSSGLAHPARDRDADGSMREGQEEGGIEDMAVRLAHLGILHWRVWAQLVYLGDADDMSVDAPPPGQI*
Coding >Hirsu2|5275
ATGGAACAGGGCTTTGGGGGAGGACCCGTCGAGAGGTCGCGGCGTAGCTTGTCCACCTCGGCTCCCGTGTCCAAC
CCCGAGGGCGAGTCCATGAAGGACCCCGACGTCCAGATGCAACAACCGCCCCAGAACGAGACGGAGAAGAAGGTC
ATCTCATCCCCGTCCCAGGAGTCGCCCCGGCGGTGCGAGGCTGCCGTTCGAGCATCTTCTCCCGCCTCGGCCGCA
CTGTCGCGGACCGCCTCGAACAGCACACAGCCGGGCACCCCCGTGGCCGACACCGCCCCGAACCGCAAACACAGC
CGCCATGCCGCTGCGCACGCCTGGCCGGCAGAGCCCCCGGTGACCCGTTCGACCCTGAGCGAGCTCGACGTGTCC
AAGATCATTCACAACCCCAAGCTCCGCCACGACATCAACTTCGACCCGGAGCTCCACTTCCGACCCAACCTGGAC
GGCGAGAAGGGCAGGAAGAAGCAAGACCGGGCCAACCAGTTTTGGAAGACGCTCAAGGAGGAGCTGACGGACTTC
CTGACGGATCGCGCGGCCTTTGTGCACAAGCACGCGGCCAGGAACGACTGGACGCTGCCCGCGCTGCTCAAGGCG
GTCAAGGAGATTATCCAGACGCTGGTGCCCCAGCGTGACCGCCAGTTCCTGGACGAAGGCCTCAATGTCGAGCTC
CTGATGCAGCAGTTCTACAAGGGCGTCGCCGACTTGGAAAAGCTGGCTCTTTGGCTCTCGCGCGTGCTCAAGTCG
CACTGCGCCCCCATGCGCGATGACTGGGTCGACACCATGTACTCGCAGCTCAGCAGTGGCAACCGGAACGCCGAC
CTCGACGAGCTCGTCACGGGCATGCGTAGCCTGCTCAGCGTGCTCGAGGCCATGAAGCTGGATGTGGCCAACCAC
CAGATTCGCTGCCTGCGCCCCGTCCTCATCGAGGACACGACGCACTTTGAGCAAAAGTTCTTCCTCCGCAAGATG
CAGTCCAACAAGGTCGACACGAGCGGGGCCAGGCGCTGGTACGTCGACGCCGACCGAAGACTGTCGCCCGCCCTG
GGGAACACGTCGCACACGTTCGGCGAGATGGGTGTCTTCTTCGAGGCCCTGACGCACCTGGTCCTGCCCTCGACG
GCCGAGAAGCGCGTGCCCAGCACCTTTCTCTTTGACGAGGAGCGCATCCTGAAGCTGCGGTCGGACATGCTCGAC
GCCATCAATCTCGAGGTCTGCATGCGCATGTACGACGACCTGGACCGGGTCGGACGCCTGAGCTCGCGCATGTTC
GGCGCCAGCCGCGCCCTGGACGAGGATGCGCTGAACCGGTCGGTCTCGCCCAGCTGCGAGTTCAACTTCAACACG
CCCCTGTCCACGTCGCGCCCGTCCAGCCTCGCCCTGAGCTCCGCCGGATCCGCGTCGTCCTCGCCGAGGTCCTCG
CTGGTCATGCCCTCGTACGTGGCCCCCGAAAGCGGCGAGGACCGCGCCCGCTCGCGGACCGTCTTCAACACGCTC
GTCGCCCTCCTGCAGTCGGCGGCCCCGACGTCGCGCCCCTACGTCCGCTGGCAGGAGATCGCCCCGTCCATGGCC
CTGCAGATCTTCCGCTACACCAACGCGCCGTCTGAGATGCTGCCCGCCTTCGAGGAGAAGCTAACGGAGAACGTG
TGCCACGCGAGCTCCCAGCTCTACCTCGAGGTCGAGCAGGCGTTCCACAGCAAGCTGATGACGGAGCTGGGCTGC
CGCGTTCGCGAGTTCAAGGTCCTGTCCGGCGTGTCGCTCTTCGCCGTGGCCACGGGCGGCCGCGTCCAGAGCGGC
AGCGGCAGCAGCAGCGGCCTCGCCCACCCCGCGCGGGACCGCGACGCGGACGGATCGATGCGCGAGGGCCAGGAG
GAGGGTGGCATCGAGGACATGGCCGTCCGTCTGGCCCACCTCGGCATCTTGCATTGGCGAGTGTGGGCACAGCTG
GTCTACCTGGGCGACGCCGACGACATGTCTGTGGACGCGCCCCCGCCCGGCCAGATATGA
Transcript >Hirsu2|5275
ATGGAACAGGGCTTTGGGGGAGGACCCGTCGAGAGGTCGCGGCGTAGCTTGTCCACCTCGGCTCCCGTGTCCAAC
CCCGAGGGCGAGTCCATGAAGGACCCCGACGTCCAGATGCAACAACCGCCCCAGAACGAGACGGAGAAGAAGGTC
ATCTCATCCCCGTCCCAGGAGTCGCCCCGGCGGTGCGAGGCTGCCGTTCGAGCATCTTCTCCCGCCTCGGCCGCA
CTGTCGCGGACCGCCTCGAACAGCACACAGCCGGGCACCCCCGTGGCCGACACCGCCCCGAACCGCAAACACAGC
CGCCATGCCGCTGCGCACGCCTGGCCGGCAGAGCCCCCGGTGACCCGTTCGACCCTGAGCGAGCTCGACGTGTCC
AAGATCATTCACAACCCCAAGCTCCGCCACGACATCAACTTCGACCCGGAGCTCCACTTCCGACCCAACCTGGAC
GGCGAGAAGGGCAGGAAGAAGCAAGACCGGGCCAACCAGTTTTGGAAGACGCTCAAGGAGGAGCTGACGGACTTC
CTGACGGATCGCGCGGCCTTTGTGCACAAGCACGCGGCCAGGAACGACTGGACGCTGCCCGCGCTGCTCAAGGCG
GTCAAGGAGATTATCCAGACGCTGGTGCCCCAGCGTGACCGCCAGTTCCTGGACGAAGGCCTCAATGTCGAGCTC
CTGATGCAGCAGTTCTACAAGGGCGTCGCCGACTTGGAAAAGCTGGCTCTTTGGCTCTCGCGCGTGCTCAAGTCG
CACTGCGCCCCCATGCGCGATGACTGGGTCGACACCATGTACTCGCAGCTCAGCAGTGGCAACCGGAACGCCGAC
CTCGACGAGCTCGTCACGGGCATGCGTAGCCTGCTCAGCGTGCTCGAGGCCATGAAGCTGGATGTGGCCAACCAC
CAGATTCGCTGCCTGCGCCCCGTCCTCATCGAGGACACGACGCACTTTGAGCAAAAGTTCTTCCTCCGCAAGATG
CAGTCCAACAAGGTCGACACGAGCGGGGCCAGGCGCTGGTACGTCGACGCCGACCGAAGACTGTCGCCCGCCCTG
GGGAACACGTCGCACACGTTCGGCGAGATGGGTGTCTTCTTCGAGGCCCTGACGCACCTGGTCCTGCCCTCGACG
GCCGAGAAGCGCGTGCCCAGCACCTTTCTCTTTGACGAGGAGCGCATCCTGAAGCTGCGGTCGGACATGCTCGAC
GCCATCAATCTCGAGGTCTGCATGCGCATGTACGACGACCTGGACCGGGTCGGACGCCTGAGCTCGCGCATGTTC
GGCGCCAGCCGCGCCCTGGACGAGGATGCGCTGAACCGGTCGGTCTCGCCCAGCTGCGAGTTCAACTTCAACACG
CCCCTGTCCACGTCGCGCCCGTCCAGCCTCGCCCTGAGCTCCGCCGGATCCGCGTCGTCCTCGCCGAGGTCCTCG
CTGGTCATGCCCTCGTACGTGGCCCCCGAAAGCGGCGAGGACCGCGCCCGCTCGCGGACCGTCTTCAACACGCTC
GTCGCCCTCCTGCAGTCGGCGGCCCCGACGTCGCGCCCCTACGTCCGCTGGCAGGAGATCGCCCCGTCCATGGCC
CTGCAGATCTTCCGCTACACCAACGCGCCGTCTGAGATGCTGCCCGCCTTCGAGGAGAAGCTAACGGAGAACGTG
TGCCACGCGAGCTCCCAGCTCTACCTCGAGGTCGAGCAGGCGTTCCACAGCAAGCTGATGACGGAGCTGGGCTGC
CGCGTTCGCGAGTTCAAGGTCCTGTCCGGCGTGTCGCTCTTCGCCGTGGCCACGGGCGGCCGCGTCCAGAGCGGC
AGCGGCAGCAGCAGCGGCCTCGCCCACCCCGCGCGGGACCGCGACGCGGACGGATCGATGCGCGAGGGCCAGGAG
GAGGGTGGCATCGAGGACATGGCCGTCCGTCTGGCCCACCTCGGCATCTTGCATTGGCGAGTGTGGGCACAGCTG
GTCTACCTGGGCGACGCCGACGACATGTCTGTGGACGCGCCCCCGCCCGGCCAGATATGA
Gene >Hirsu2|5275
ATGGAACAGGGCTTTGGGGGAGGACCCGTCGAGAGGTCGCGGCGTAGCTTGTCCACCTCGGCTCCCGTGTCCAAC
CCCGAGGGCGAGTCCATGAAGGACCCCGACGTCCAGATGCAACAACCGCCCCAGAACGAGACGGAGAAGAAGGTC
ATCTCATCCCCGTCCCAGGAGTCGCCCCGGCGGTGCGAGGCTGCCGTTCGAGCATCTTCTCCCGCCTCGGCCGCA
CTGTCGCGGACCGCCTCGAACAGCACACAGCCGGGCACCCCCGTGGCCGACACCGCCCCGAACCGCAAACACAGC
CGCCATGCCGCTGCGCACGCCTGGCCGGCAGAGCCCCCGGTGACCCGTTCGACCCTGAGCGAGCTCGACGTGTCC
AAGATCATTCACAACCCCAAGCTCCGCCACGACATCAACTTCGACCCGGAGCTCCACTTCCGACCCAACCTGGAC
GGCGAGAAGGGCAGGAAGAAGCAAGACCGGGCCAACCAGTTTTGGAAGACGCTCAAGGAGGAGCTGACGGACTTC
CTGACGGATCGCGCGGCCTTTGTGCACAAGCACGCGGCCAGGAACGACTGGACGCTGCCCGCGCTGCTCAAGGCG
GTCAAGGAGATTATCCAGACGCTGGTGCCCCAGCGTGACCGCCAGTTCCTGGACGAAGGCCTCAATGTCGAGCTC
CTGATGCAGCAGTTCTACAAGGGCGTCGCCGACTTGGAAAAGCTGGCTCTTTGGCTCTCGCGCGTGCTCAAGTCG
CACTGCGCCCCCATGCGCGATGACTGGGTCGACACCATGTACTCGCAGCTCAGCAGTGGCAACCGGAACGCCGAC
CTCGACGAGCTCGTCACGGGCATGCGTAGCCTGCTCAGCGTGCTCGAGGCCATGAAGCTGGATGTGGCCAACCAC
CAGATTCGCTGCCTGCGCCCCGTCCTCATCGAGGACACGACGCACTTTGAGCAAAAGTTCTTCCTCCGCAAGATG
CAGTCCAACAAGGTCGACACGAGCGGGGCCAGGCGCTGGTACGTCGACGCCGACCGAAGACTGTCGCCCGCCCTG
GGGAACACGTCGCACACGTTCGGCGAGATGGGTGTCTTCTTCGAGGCCCTGACGCACCTGGTCCTGCCCTCGACG
GCCGAGAAGCGCGTGCCCAGCACCTTTCTCTTTGACGAGGAGCGCATCCTGAAGCTGCGGTCGGACATGCTCGAC
GCCATCAATCTCGAGGTCTGCATGCGCATGTACGACGACCTGGACCGGGTCGGACGCCTGAGCTCGCGCATGTTC
GGCGCCAGCCGCGCCCTGGACGAGGATGCGCTGAACCGGTCGGTCTCGCCCAGCTGCGAGTTCAACTTCAACACG
CCCCTGTCCACGTCGCGCCCGTCCAGCCTCGCCCTGAGCTCCGCCGGATCCGCGTCGTCCTCGCCGAGGTCCTCG
CTGGTCATGCCCTCGTACGTGGCCCCCGAAAGCGGCGAGGACCGCGCCCGCTCGCGGACCGTCTTCAACACGCTC
GTCGCCCTCCTGCAGTCGGCGGCCCCGACGTCGCGCCCCTACGTCCGCTGGCAGGAGATCGCCCCGTCCATGGCC
CTGCAGATCTTCCGCTACACCAACGCGCCGTCTGAGATGCTGCCCGCCTTCGAGGAGAAGCTAACGGAGAACGTG
TGCCACGCGAGCTCCCAGCTCTACCTCGAGGTCGAGCAGGCGTTCCACAGCAAGCTGATGACGGAGCTGGGCTGC
CGCGTTCGCGAGTTCAAGGTCCTGTCCGGCGTGTCGCTCTTCGCCGTGGCCACGGGCGGCCGCGTCCAGAGCGGC
AGCGGCAGCAGCAGCGGCCTCGCCCACCCCGCGCGGGACCGCGACGCGGACGGATCGATGCGCGAGGGCCAGGAG
GAGGGTGGCATCGAGGACATGGCCGTCCGTCTGGCCCACCTCGGCATCTTGCATTGGCGAGTGTGGGCACAGCTG
GTCTACCTGGGCGACGCCGACGACATGTCTGTGGACGCGCCCCCGCCCGGCCAGATATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail