Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5265
Gene name
LocationContig_263:1360..2362
Strand-
Gene length (bp)1002
Transcript length (bp)864
Coding sequence length (bp)864
Protein length (aa) 288

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00887 ACBP Acyl CoA binding protein 3.9E-23 7 99

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C4R8D7|ATG37_PICPG Autophagy-related protein 37 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PAS_chr4_0602 PE=1 SV=1 1 136 2.0E-32
sp|Q20507|ACBP3_CAEEL Acyl-CoA-binding protein homolog 3 OS=Caenorhabditis elegans GN=acbp-3 PE=3 SV=2 4 107 7.0E-10
sp|P0C8L7|ACBP_HYPDU Putative acyl-CoA-binding protein OS=Hypsibius dujardini PE=3 SV=1 4 91 3.0E-07
sp|P31824|ACBP_MANSE Acyl-CoA-binding protein homolog OS=Manduca sexta PE=3 SV=1 4 98 4.0E-07
sp|P61867|ACBP2_SACPS Acyl-CoA-binding protein 2 OS=Saccharomyces pastorianus GN=ACB2 PE=1 SV=2 5 103 5.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C4R8D7|ATG37_PICPG Autophagy-related protein 37 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PAS_chr4_0602 PE=1 SV=1 1 136 2.0E-32
sp|Q20507|ACBP3_CAEEL Acyl-CoA-binding protein homolog 3 OS=Caenorhabditis elegans GN=acbp-3 PE=3 SV=2 4 107 7.0E-10
sp|P0C8L7|ACBP_HYPDU Putative acyl-CoA-binding protein OS=Hypsibius dujardini PE=3 SV=1 4 91 3.0E-07
sp|P31824|ACBP_MANSE Acyl-CoA-binding protein homolog OS=Manduca sexta PE=3 SV=1 4 98 4.0E-07
sp|P61867|ACBP2_SACPS Acyl-CoA-binding protein 2 OS=Saccharomyces pastorianus GN=ACB2 PE=1 SV=2 5 103 5.0E-07
sp|P61868|ACBP2_SACMO Acyl-CoA-binding protein 2 OS=Saccharomyces pastorianus (strain ATCC 76670 / Carlsberg bottom yeast no.2 / CBS 1503 / CLIB 180 / NBRC 10610 / NRRL Y-1525) GN=ACB2 PE=3 SV=2 5 103 5.0E-07
sp|P42281|ACBP_DROME Acyl-CoA-binding protein homolog OS=Drosophila melanogaster GN=Dbi PE=2 SV=1 5 102 8.0E-07
sp|P31787|ACBP_YEAST Acyl-CoA-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACB1 PE=1 SV=3 5 103 2.0E-06
sp|P45882|ACBP_ANAPL Acyl-CoA-binding protein OS=Anas platyrhynchos GN=DBI PE=3 SV=1 9 102 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0000062 fatty-acyl-CoA binding Yes
GO:0036094 small molecule binding No
GO:0003674 molecular_function No
GO:1901567 fatty acid derivative binding No
GO:0017076 purine nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0032555 purine ribonucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0050662 coenzyme binding No
GO:1901681 sulfur compound binding No
GO:0033218 amide binding No
GO:0048037 cofactor binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 234 256 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5265
MADSVDRVFVHALNTVKKIPKTGASRPPPSDRLRLYGLYKQAMEGDVDGVMEQPAPAPGLTAEDLQRERDKWHAW
NSQRGLSRTEAKRRYVEALIKTMHRYATTSDATELVAELEFVWNQIKHNSPSSSDSSPKAGGGGGGRRQQFQAPL
SGTDGPMKVLTPMSEQDEAELRSQRQMELEDDAAGAADSSRWQRKMERAVTNLSAQVAALREQIATGREWKSKKQ
RSFPAWLRWAAWLVMKHLVADLVVLALVLLWMRKRKDRRLEDLVRAAFRLGREYVRKVLPSR*
Coding >Hirsu2|5265
ATGGCCGACTCCGTGGATCGGGTCTTCGTCCACGCGCTCAACACCGTCAAGAAGATACCCAAGACGGGCGCGTCG
CGGCCGCCGCCGTCGGACCGCCTGCGTCTCTACGGCCTCTACAAGCAGGCCATGGAGGGGGACGTGGACGGGGTC
ATGGAGCAGCCCGCGCCCGCGCCCGGGCTGACGGCGGAAGACCTGCAGAGGGAACGGGACAAGTGGCACGCCTGG
AACTCGCAGAGGGGCCTGAGCCGGACCGAGGCCAAACGGCGATACGTCGAGGCCCTCATCAAGACGATGCATCGA
TACGCCACCACGTCGGATGCTACTGAGCTGGTAGCCGAGCTCGAGTTCGTCTGGAACCAAATCAAGCACAACTCG
CCCAGCTCGTCCGACTCGTCGCCCAAGGCGGGCGGCGGCGGCGGCGGGCGGCGGCAGCAGTTCCAGGCGCCGCTG
AGCGGCACCGACGGCCCGATGAAGGTGCTGACGCCCATGAGCGAGCAGGACGAGGCCGAGCTGCGGTCGCAGCGG
CAGATGGAGCTCGAGGACGACGCGGCGGGGGCGGCGGACAGCAGCCGCTGGCAGCGCAAGATGGAGCGCGCCGTC
ACCAACCTGTCGGCCCAGGTGGCGGCGCTGCGCGAGCAGATCGCGACGGGGCGCGAGTGGAAGTCGAAGAAGCAG
CGCAGCTTCCCGGCCTGGCTCCGCTGGGCGGCGTGGCTGGTGATGAAGCACCTGGTCGCCGACCTCGTCGTCCTC
GCCCTCGTCCTGCTGTGGATGCGGAAGCGCAAGGACCGGCGGCTCGAGGACCTGGTGCGGGCCGCCTTCCGGCTG
GGCCGGGAATACGTCCGCAAGGTCCTCCCGTCCAGGTGA
Transcript >Hirsu2|5265
ATGGCCGACTCCGTGGATCGGGTCTTCGTCCACGCGCTCAACACCGTCAAGAAGATACCCAAGACGGGCGCGTCG
CGGCCGCCGCCGTCGGACCGCCTGCGTCTCTACGGCCTCTACAAGCAGGCCATGGAGGGGGACGTGGACGGGGTC
ATGGAGCAGCCCGCGCCCGCGCCCGGGCTGACGGCGGAAGACCTGCAGAGGGAACGGGACAAGTGGCACGCCTGG
AACTCGCAGAGGGGCCTGAGCCGGACCGAGGCCAAACGGCGATACGTCGAGGCCCTCATCAAGACGATGCATCGA
TACGCCACCACGTCGGATGCTACTGAGCTGGTAGCCGAGCTCGAGTTCGTCTGGAACCAAATCAAGCACAACTCG
CCCAGCTCGTCCGACTCGTCGCCCAAGGCGGGCGGCGGCGGCGGCGGGCGGCGGCAGCAGTTCCAGGCGCCGCTG
AGCGGCACCGACGGCCCGATGAAGGTGCTGACGCCCATGAGCGAGCAGGACGAGGCCGAGCTGCGGTCGCAGCGG
CAGATGGAGCTCGAGGACGACGCGGCGGGGGCGGCGGACAGCAGCCGCTGGCAGCGCAAGATGGAGCGCGCCGTC
ACCAACCTGTCGGCCCAGGTGGCGGCGCTGCGCGAGCAGATCGCGACGGGGCGCGAGTGGAAGTCGAAGAAGCAG
CGCAGCTTCCCGGCCTGGCTCCGCTGGGCGGCGTGGCTGGTGATGAAGCACCTGGTCGCCGACCTCGTCGTCCTC
GCCCTCGTCCTGCTGTGGATGCGGAAGCGCAAGGACCGGCGGCTCGAGGACCTGGTGCGGGCCGCCTTCCGGCTG
GGCCGGGAATACGTCCGCAAGGTCCTCCCGTCCAGGTGA
Gene >Hirsu2|5265
ATGGCCGACTCCGTGGGTAGGTGGCCCCGTCATCGAGCGGTCGCAAGGGCGCCATCGGGATGCTGACCCGCCGGT
TGCCTCGACACAGATCGGGTCTTCGTCCACGCGCTCAACACCGTCAAGAAGATACCCAAGACGGGCGCGTCGCGG
CCGCCGCCGTCGGACCGCCTGCGTCTCTACGGCCTCTACAAGCAGGCCATGGAGGGGGACGTGGACGGGGTCATG
GAGCAGCCCGCGCCCGCGCCCGGGCTGACGGCGGAAGACCTGCAGAGGGAACGGGACAAGTGGCACGCCTGGAAC
TCGCAGAGGGGCCTGAGCCGGACCGAGGCCAAACGGCGATACGTCGAGGCCCTCATCAAGACGATGCATCGATAC
GCCACCACGTCGTAAGCCTCGGCCAGCACGGAAGGGGTGGGCAGACGGTTGCGGCTGACTGGAACTCTTTTTGTC
AGGGATGCTACTGAGCTGGTAGCCGAGCTCGAGTTCGTCTGGAACCAAATCAAGCACAACTCGCCCAGCTCGTCC
GACTCGTCGCCCAAGGCGGGCGGCGGCGGCGGCGGGCGGCGGCAGCAGTTCCAGGCGCCGCTGAGCGGCACCGAC
GGCCCGATGAAGGTGCTGACGCCCATGAGCGAGCAGGACGAGGCCGAGCTGCGGTCGCAGCGGCAGATGGAGCTC
GAGGACGACGCGGCGGGGGCGGCGGACAGCAGCCGCTGGCAGCGCAAGATGGAGCGCGCCGTCACCAACCTGTCG
GCCCAGGTGGCGGCGCTGCGCGAGCAGATCGCGACGGGGCGCGAGTGGAAGTCGAAGAAGCAGCGCAGCTTCCCG
GCCTGGCTCCGCTGGGCGGCGTGGCTGGTGATGAAGCACCTGGTCGCCGACCTCGTCGTCCTCGCCCTCGTCCTG
CTGTGGATGCGGAAGCGCAAGGACCGGCGGCTCGAGGACCTGGTGCGGGCCGCCTTCCGGCTGGGCCGGGAATAC
GTCCGCAAGGTCCTCCCGTCCAGGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail