Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5259
Gene name
LocationContig_2626:639..2103
Strand+
Gene length (bp)1464
Transcript length (bp)1227
Coding sequence length (bp)1227
Protein length (aa) 409

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03721 UDPG_MGDP_dh_N UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain 1.2E-15 39 112
PF03721 UDPG_MGDP_dh_N UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain 8.7E-32 128 254
PF00984 UDPG_MGDP_dh UDP-glucose/GDP-mannose dehydrogenase family, central domain 7.8E-32 277 371

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2QS13|UGDH5_ORYSJ UDP-glucose 6-dehydrogenase 5 OS=Oryza sativa subsp. japonica GN=UGD5 PE=2 SV=1 40 405 2.0E-138
sp|Q2QS14|UGDH4_ORYSJ UDP-glucose 6-dehydrogenase 4 OS=Oryza sativa subsp. japonica GN=UGD4 PE=2 SV=1 40 405 5.0E-138
sp|Q9AUV6|UGDH3_ORYSJ UDP-glucose 6-dehydrogenase 3 OS=Oryza sativa subsp. japonica GN=UGD3 PE=2 SV=1 40 405 8.0E-138
sp|O02373|UGDH_DROME UDP-glucose 6-dehydrogenase OS=Drosophila melanogaster GN=sgl PE=1 SV=1 40 405 5.0E-137
sp|Q96558|UGDH1_SOYBN UDP-glucose 6-dehydrogenase 1 OS=Glycine max GN=UGD1 PE=2 SV=1 40 405 1.0E-136
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2QS13|UGDH5_ORYSJ UDP-glucose 6-dehydrogenase 5 OS=Oryza sativa subsp. japonica GN=UGD5 PE=2 SV=1 40 405 2.0E-138
sp|Q2QS14|UGDH4_ORYSJ UDP-glucose 6-dehydrogenase 4 OS=Oryza sativa subsp. japonica GN=UGD4 PE=2 SV=1 40 405 5.0E-138
sp|Q9AUV6|UGDH3_ORYSJ UDP-glucose 6-dehydrogenase 3 OS=Oryza sativa subsp. japonica GN=UGD3 PE=2 SV=1 40 405 8.0E-138
sp|O02373|UGDH_DROME UDP-glucose 6-dehydrogenase OS=Drosophila melanogaster GN=sgl PE=1 SV=1 40 405 5.0E-137
sp|Q96558|UGDH1_SOYBN UDP-glucose 6-dehydrogenase 1 OS=Glycine max GN=UGD1 PE=2 SV=1 40 405 1.0E-136
sp|Q75GS4|UGDH1_ORYSJ UDP-glucose 6-dehydrogenase 1 OS=Oryza sativa subsp. japonica GN=UGD1 PE=3 SV=1 40 405 2.0E-135
sp|Q5R7B3|UGDH_PONAB UDP-glucose 6-dehydrogenase OS=Pongo abelii GN=UGDH PE=2 SV=1 37 405 2.0E-135
sp|Q9FZE1|UGDH1_ARATH UDP-glucose 6-dehydrogenase 1 OS=Arabidopsis thaliana GN=UGD1 PE=2 SV=1 40 405 2.0E-135
sp|P12378|UGDH_BOVIN UDP-glucose 6-dehydrogenase OS=Bos taurus GN=UGDH PE=1 SV=2 37 405 3.0E-135
sp|O60701|UGDH_HUMAN UDP-glucose 6-dehydrogenase OS=Homo sapiens GN=UGDH PE=1 SV=1 37 405 4.0E-135
sp|Q9FM01|UGDH4_ARATH UDP-glucose 6-dehydrogenase 4 OS=Arabidopsis thaliana GN=UGD4 PE=1 SV=1 40 405 2.0E-134
sp|O70475|UGDH_MOUSE UDP-glucose 6-dehydrogenase OS=Mus musculus GN=Ugdh PE=1 SV=1 35 405 2.0E-134
sp|Q9LF33|UGDH3_ARATH UDP-glucose 6-dehydrogenase 3 OS=Arabidopsis thaliana GN=UGD3 PE=1 SV=1 40 405 2.0E-134
sp|O70199|UGDH_RAT UDP-glucose 6-dehydrogenase OS=Rattus norvegicus GN=Ugdh PE=1 SV=1 35 405 3.0E-134
sp|B7F958|UGDH2_ORYSJ UDP-glucose 6-dehydrogenase 2 OS=Oryza sativa subsp. japonica GN=UGD2 PE=2 SV=1 40 405 4.0E-134
sp|Q9LIA8|UGDH2_ARATH UDP-glucose 6-dehydrogenase 2 OS=Arabidopsis thaliana GN=UGD2 PE=1 SV=1 40 405 2.0E-133
sp|Q5F3T9|UGDH_CHICK UDP-glucose 6-dehydrogenase OS=Gallus gallus GN=UGDH PE=2 SV=1 37 405 3.0E-133
sp|Q19905|UGDH_CAEEL UDP-glucose 6-dehydrogenase OS=Caenorhabditis elegans GN=sqv-4 PE=1 SV=1 37 405 1.0E-127
sp|O86422|UDG_PSEAE UDP-glucose 6-dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=udg PE=3 SV=2 40 405 5.0E-56
sp|O32271|TUAD_BACSU UDP-glucose 6-dehydrogenase TuaD OS=Bacillus subtilis (strain 168) GN=tuaD PE=1 SV=1 37 405 2.0E-53
sp|O54068|UDG_RHIME UDP-glucose 6-dehydrogenase OS=Rhizobium meliloti (strain 1021) GN=rkpK PE=3 SV=2 40 405 2.0E-51
sp|Q4UK39|UDG_RICFE UDP-glucose 6-dehydrogenase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=udg PE=3 SV=1 39 405 3.0E-49
sp|P96718|YWQF_BACSU UDP-glucose 6-dehydrogenase YwqF OS=Bacillus subtilis (strain 168) GN=ywqF PE=1 SV=1 40 405 6.0E-49
sp|O05973|UDG_RICPR UDP-glucose 6-dehydrogenase OS=Rickettsia prowazekii (strain Madrid E) GN=udg PE=3 SV=1 39 405 1.0E-48
sp|Q68VX0|UDG_RICTY UDP-glucose 6-dehydrogenase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=udg PE=3 SV=1 39 405 8.0E-48
sp|Q92GB1|UDG_RICCN UDP-glucose 6-dehydrogenase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=udg PE=3 SV=1 39 405 8.0E-48
sp|O34862|YTCA_BACSU Putative UDP-glucose 6-dehydrogenase YtcA OS=Bacillus subtilis (strain 168) GN=ytcA PE=3 SV=1 40 405 2.0E-47
sp|Q1RKF8|UDG_RICBR UDP-glucose 6-dehydrogenase OS=Rickettsia bellii (strain RML369-C) GN=udg PE=3 SV=1 40 405 8.0E-44
sp|D4GYH5|AGLM_HALVD UDP-glucose 6-dehydrogenase AglM OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=aglM PE=1 SV=1 40 405 3.0E-36
sp|Q58454|Y1054_METJA Uncharacterized protein MJ1054 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1054 PE=3 SV=1 39 343 2.0E-33
sp|A6VK13|WECC_METM7 UDP-N-acetyl-D-mannosamine dehydrogenase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=wecC PE=3 SV=1 36 408 8.0E-22
sp|Q6LZC3|WECC_METMP UDP-N-acetyl-D-mannosamine dehydrogenase OS=Methanococcus maripaludis (strain S2 / LL) GN=wecC PE=1 SV=1 36 408 1.0E-21
sp|Q47329|UDG5_ECOLX UDP-glucose 6-dehydrogenase OS=Escherichia coli GN=kfiD PE=3 SV=1 117 383 1.0E-20
sp|P11759|ALGD_PSEAE GDP-mannose 6-dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=algD PE=1 SV=2 40 405 1.0E-20
sp|Q8Z389|WECC_SALTI UDP-N-acetyl-D-mannosamine dehydrogenase OS=Salmonella typhi GN=wecC PE=3 SV=1 39 404 2.0E-20
sp|P67066|WECC_ECO57 UDP-N-acetyl-D-mannosamine dehydrogenase OS=Escherichia coli O157:H7 GN=wecC PE=3 SV=1 39 404 2.0E-20
sp|P27829|WECC_ECOLI UDP-N-acetyl-D-mannosamine dehydrogenase OS=Escherichia coli (strain K12) GN=wecC PE=1 SV=4 39 404 2.0E-20
sp|P67067|WECC_SHIFL UDP-N-acetyl-D-mannosamine dehydrogenase OS=Shigella flexneri GN=wecC PE=3 SV=1 39 404 2.0E-20
sp|A6USK4|WECC_METVS UDP-N-acetyl-D-mannosamine dehydrogenase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=wecC PE=3 SV=1 37 408 3.0E-20
sp|A4FY94|WECC_METM5 UDP-N-acetyl-D-mannosamine dehydrogenase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=wecC PE=3 SV=1 36 408 4.0E-20
sp|Q04873|UDG_SALTY UDP-glucose 6-dehydrogenase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=udg PE=3 SV=1 117 357 2.0E-19
sp|P58591|EPSD_RALSO NDP-N-acetyl-D-galactosaminuronic acid dehydrogenase OS=Ralstonia solanacearum (strain GMI1000) GN=epsD PE=3 SV=1 35 404 2.0E-19
sp|P76373|UDG_ECOLI UDP-glucose 6-dehydrogenase OS=Escherichia coli (strain K12) GN=ugd PE=1 SV=1 117 357 3.0E-19
sp|P37791|UDG_SHIFL Putative UDP-glucose 6-dehydrogenase OS=Shigella flexneri GN=udg PE=5 SV=1 117 357 4.0E-19
sp|Q8FG45|UDG_ECOL6 UDP-glucose 6-dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ugd PE=3 SV=1 117 357 4.0E-19
sp|Q9L6R4|WECC_SALTY UDP-N-acetyl-D-mannosamine dehydrogenase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=wecC PE=3 SV=1 39 404 5.0E-19
sp|O33952|UDG8_ECOLX UDP-glucose 6-dehydrogenase OS=Escherichia coli GN=ugd PE=3 SV=1 40 357 5.0E-19
sp|Q7DBF9|UDG_ECO57 UDP-glucose 6-dehydrogenase OS=Escherichia coli O157:H7 GN=ugd PE=3 SV=1 117 357 7.0E-19
sp|Q04872|UDG_ECO11 UDP-glucose 6-dehydrogenase OS=Escherichia coli O111:H- GN=ugd PE=3 SV=1 40 357 1.0E-18
sp|P59793|ALGD_PSESY GDP-mannose 6-dehydrogenase OS=Pseudomonas syringae pv. syringae GN=algD PE=3 SV=1 40 405 2.0E-18
sp|O07299|ALGD_PSESH GDP-mannose 6-dehydrogenase OS=Pseudomonas savastanoi pv. phaseolicola GN=algD PE=3 SV=1 40 405 4.0E-18
sp|Q45410|EPSD_RALSL NDP-N-acetyl-D-galactosaminuronic acid dehydrogenase OS=Ralstonia solanacearum GN=epsD PE=3 SV=1 35 404 6.0E-18
sp|Q8ZAE4|WECC_YERPE UDP-N-acetyl-D-mannosamine dehydrogenase OS=Yersinia pestis GN=wecC PE=3 SV=1 35 404 8.0E-18
sp|Q887P8|ALGD_PSESM GDP-mannose 6-dehydrogenase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=algD PE=2 SV=1 40 405 2.0E-17
sp|P51585|ALGD_AZOVI GDP-mannose 6-dehydrogenase OS=Azotobacter vinelandii GN=algD PE=3 SV=1 40 405 7.0E-17
sp|Q88NC4|ALGD_PSEPK GDP-mannose 6-dehydrogenase OS=Pseudomonas putida (strain KT2440) GN=algD PE=3 SV=1 40 405 9.0E-17
sp|Q57346|UDG_STREE UDP-glucose 6-dehydrogenase OS=Streptococcus pneumoniae GN=cap3A PE=3 SV=2 40 347 6.0E-16
sp|A6UU98|WECC_META3 UDP-N-acetyl-D-mannosamine dehydrogenase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=wecC PE=3 SV=1 37 408 3.0E-15
sp|Q57871|WECC_METJA UDP-N-acetyl-D-mannosamine dehydrogenase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=wecC PE=3 SV=1 38 343 7.0E-14
sp|P0DG69|UDG_STRPQ UDP-glucose 6-dehydrogenase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=hasB PE=3 SV=1 117 358 1.0E-12
sp|P0DG68|UDG_STRP3 UDP-glucose 6-dehydrogenase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=hasB PE=3 SV=1 117 358 2.0E-12
sp|P0C0F5|UDG_STRP1 UDP-glucose 6-dehydrogenase OS=Streptococcus pyogenes serotype M1 GN=hasB PE=3 SV=1 136 358 2.0E-12
sp|P0C0F4|UDG_STRPY UDP-glucose 6-dehydrogenase OS=Streptococcus pyogenes GN=hasB PE=1 SV=1 136 358 2.0E-12
sp|Q8NKX0|UDG_STRP8 UDP-glucose 6-dehydrogenase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=hasB PE=3 SV=1 136 358 2.0E-12
sp|Q5X9A8|UDG_STRP6 UDP-glucose 6-dehydrogenase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=hasB PE=3 SV=1 136 358 2.0E-12
sp|P39861|CAPL_STAAU Protein CapL OS=Staphylococcus aureus GN=capL PE=3 SV=1 38 404 2.0E-07
sp|G3XD94|UGND_PSEAE UDP-N-acetyl-D-glucosamine 6-dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=wbpA PE=1 SV=1 123 404 5.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0051287 NAD binding Yes
GO:0055114 oxidation-reduction process Yes
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Yes
GO:0000166 nucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0097159 organic cyclic compound binding No
GO:0050662 coenzyme binding No
GO:0036094 small molecule binding No
GO:0008150 biological_process No
GO:0048037 cofactor binding No
GO:1901363 heterocyclic compound binding No
GO:0008152 metabolic process No
GO:0016491 oxidoreductase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5259
MTVMASIPDAVVASVKKLGLNGSSEHANGAFEAAVNVRTICCVGAGYVGGPTAAVIAFQNPHIRVTVVDRDEIRI
RRWNSRHPPIYEPGLHDIVRVARDGGRETSFSNEPTSDVEGSPVDEARAKMPRRAANLFFTTDVATSIAEADVVL
VAVNTPTKERGVGAGSATDMTAFEAVTAVVARYAREGAIIVEKSTVPCRTAQLVADTLSMHRPGVHFEILSNPEF
LAAGTAVNDLLYPDRILIGSAPTPSGKRAAEALVGVYAAWVPRERILTTNVWSSELAKLVANSMLAQRISSINSI
SAVCEQTGADVDEVARAIGVDPRIGNKFLMAGIGFGGSCFKKDVLNLVYLADTMGLPEVGEYWRQVVKMNDYARD
RFTNRVIKCLNNTLVGKKVTILGYAFKKNTRRS*
Coding >Hirsu2|5259
ATGACTGTCATGGCTTCCATCCCCGACGCCGTCGTCGCCTCGGTCAAGAAGCTCGGCCTCAATGGCTCCTCGGAG
CACGCCAACGGCGCCTTCGAGGCCGCCGTCAACGTCCGCACCATCTGCTGCGTTGGCGCTGGCTATGTCGGCGGT
CCCACCGCCGCCGTCATTGCATTCCAGAACCCTCACATCAGGGTCACCGTCGTCGACCGTGACGAGATCCGCATC
CGTCGCTGGAACTCGAGGCACCCGCCCATCTACGAGCCGGGCCTGCACGACATAGTGCGAGTCGCCCGAGACGGC
GGCCGCGAGACGAGCTTCTCCAACGAGCCCACGTCCGACGTCGAGGGCTCCCCCGTCGACGAGGCCCGCGCCAAG
ATGCCCCGTCGTGCCGCCAACCTCTTCTTCACCACCGACGTCGCCACCAGCATCGCCGAGGCCGACGTCGTCCTC
GTCGCCGTCAACACCCCCACCAAGGAGCGCGGCGTCGGCGCCGGCAGTGCCACCGACATGACGGCCTTTGAGGCC
GTCACGGCCGTCGTTGCGCGCTACGCCCGCGAGGGCGCCATCATCGTCGAGAAGAGCACCGTCCCCTGCCGGACG
GCACAGCTCGTCGCCGACACGCTGTCCATGCATCGCCCCGGCGTCCACTTCGAGATCCTGTCCAACCCCGAGTTT
CTGGCGGCCGGGACCGCCGTCAACGACCTGCTCTACCCCGACCGCATCCTCATCGGCTCCGCCCCGACGCCCTCG
GGCAAGCGCGCGGCCGAGGCCCTGGTCGGCGTCTATGCCGCCTGGGTGCCCCGCGAGCGCATCCTGACCACCAAC
GTCTGGTCCTCGGAGCTCGCCAAGCTCGTGGCCAACTCGATGCTCGCCCAGCGCATCTCGAGCATCAACTCCATC
TCGGCCGTGTGCGAGCAGACGGGCGCCGACGTCGACGAGGTGGCGCGGGCCATTGGCGTCGACCCGCGCATCGGC
AACAAGTTCCTCATGGCCGGCATCGGCTTCGGCGGAAGCTGCTTCAAGAAGGACGTCCTCAACCTCGTCTACCTG
GCCGACACCATGGGCCTGCCCGAGGTCGGCGAGTACTGGCGGCAGGTGGTCAAGATGAACGACTATGCGCGCGAC
CGCTTCACCAACCGCGTCATCAAGTGCCTCAACAACACGCTGGTCGGCAAGAAGGTGACCATCCTCGGCTACGCC
TTCAAGAAGAACACGAGGAGATCATGA
Transcript >Hirsu2|5259
ATGACTGTCATGGCTTCCATCCCCGACGCCGTCGTCGCCTCGGTCAAGAAGCTCGGCCTCAATGGCTCCTCGGAG
CACGCCAACGGCGCCTTCGAGGCCGCCGTCAACGTCCGCACCATCTGCTGCGTTGGCGCTGGCTATGTCGGCGGT
CCCACCGCCGCCGTCATTGCATTCCAGAACCCTCACATCAGGGTCACCGTCGTCGACCGTGACGAGATCCGCATC
CGTCGCTGGAACTCGAGGCACCCGCCCATCTACGAGCCGGGCCTGCACGACATAGTGCGAGTCGCCCGAGACGGC
GGCCGCGAGACGAGCTTCTCCAACGAGCCCACGTCCGACGTCGAGGGCTCCCCCGTCGACGAGGCCCGCGCCAAG
ATGCCCCGTCGTGCCGCCAACCTCTTCTTCACCACCGACGTCGCCACCAGCATCGCCGAGGCCGACGTCGTCCTC
GTCGCCGTCAACACCCCCACCAAGGAGCGCGGCGTCGGCGCCGGCAGTGCCACCGACATGACGGCCTTTGAGGCC
GTCACGGCCGTCGTTGCGCGCTACGCCCGCGAGGGCGCCATCATCGTCGAGAAGAGCACCGTCCCCTGCCGGACG
GCACAGCTCGTCGCCGACACGCTGTCCATGCATCGCCCCGGCGTCCACTTCGAGATCCTGTCCAACCCCGAGTTT
CTGGCGGCCGGGACCGCCGTCAACGACCTGCTCTACCCCGACCGCATCCTCATCGGCTCCGCCCCGACGCCCTCG
GGCAAGCGCGCGGCCGAGGCCCTGGTCGGCGTCTATGCCGCCTGGGTGCCCCGCGAGCGCATCCTGACCACCAAC
GTCTGGTCCTCGGAGCTCGCCAAGCTCGTGGCCAACTCGATGCTCGCCCAGCGCATCTCGAGCATCAACTCCATC
TCGGCCGTGTGCGAGCAGACGGGCGCCGACGTCGACGAGGTGGCGCGGGCCATTGGCGTCGACCCGCGCATCGGC
AACAAGTTCCTCATGGCCGGCATCGGCTTCGGCGGAAGCTGCTTCAAGAAGGACGTCCTCAACCTCGTCTACCTG
GCCGACACCATGGGCCTGCCCGAGGTCGGCGAGTACTGGCGGCAGGTGGTCAAGATGAACGACTATGCGCGCGAC
CGCTTCACCAACCGCGTCATCAAGTGCCTCAACAACACGCTGGTCGGCAAGAAGGTGACCATCCTCGGCTACGCC
TTCAAGAAGAACACGAGGAGATCATGA
Gene >Hirsu2|5259
ATGACTGTCATGGCTTCCATCCCCGACGCCGTCGTCGCCTCGGTCAAGAAGCTCGGCCTCAATGGCTCCTCGGAG
CACGCCAACGGCGCCTTCGAGGCCGCCGTCAACGTCCGCACCATCTGCTGCGTTGGCGCTGGCTATGTCGGTCGG
TTTTGGCCCTGCATCTGTTTCCCTCTTGCCTCTTCATCTATATCGACTGACCTCTTCTCTCTCTCGCCCACAGGC
GGTCCCACCGCCGCCGTCATTGCATTCCAGAACCCTCACATCAGGGTCACCGTCGTCGACCGTGACGAGATCCGC
ATCCGTCGCTGGAACTCGAGGCACCCGCCCATCTACGAGCCGGGCCTGCACGACATAGTGCGAGTCGCCCGAGAC
GGCGGCCGCGAGACGAGCTTCTCCAACGAGCCCACGTCCGACGTCGAGGGCTCCCCCGTCGACGAGGCCCGCGCC
AAGATGCCCCGTCGTGCCGCCAACCTCTTCTTCACCACCGACGTCGCCACCAGCATCGCCGAGGCCGACGTCGTC
CTCGTCGCCGTCAACACCCCCACCAAGGAGCGCGGCGTCGGCGCCGGCAGTGCCACCGACATGACGGCCTTTGAG
GCCGTCACGGCCGTCGTTGCGCGCTACGCCCGCGAGGGCGCCATCATCGTCGAGAAGAGCACCGTCCCCTGCCGG
ACGGCACAGCTCGTCGCCGACACGGTAAGGGACAGCCCACCCTGATCGAGCTTTCGCGAGTTGACAATGCGAAGC
TGTCCATGCATCGCCCCGGCGTCCACTTCGAGATCCTGTCCAACCCCGAGTTTCTGGCGGCCGGGACCGCCGTCA
ACGACCTGCTCTACCCCGACCGCATCCTCATCGGCTCCGCCCCGACGCCCTCGGGCAAGCGCGCGGCCGAGGCCC
TGGTCGGCGTCTATGCCGCCTGGGTGCCCCGCGAGCGCATCCTGACCACCAACGTCTGGTCCTCGGAGCTCGCCA
AGCTCGTGGCCAACTCGATGCTCGCCCAGCGCATCTCGAGCATCAACTCCATCTCGGCCGTGTGCGAGCAGACGG
GCGCCGACGTCGACGAGGTGGCGCGGGCCATTGGCGTCGACCCGCGCATCGGCAACAAGTTCCTCATGGCCGGCA
TCGGCTTCGGCGGAAGCTGCTTCAAGAAGGACGTCCTCAACCTCGTCTACCTGGCCGACACCATGGGCCTGCCCG
AGGTCGGCGAGTACTGGCGGCAGGTGGTCAAGATGAACGACTATGCGCGCGACCGCTTCACCAACCGCGTCATCA
AGTGCCTCAACAACACGCTGGTCGGCAAGAAGGTGACCATCCTCGGCTACGCCTTCAAGAAGAACACGTCGGACA
CGCGCGAGGCGCCCGCGCTCGAGATGGTCAAGACGCTGCTGGAGGAGCGCCCGCGCGAGGTGGCCGTCTTCGACC
CCTGCTGCAACCCCCTGGTCATCAAGGAGGAGATCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail