Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5251
Gene name
LocationContig_262:9671..10142
Strand-
Gene length (bp)471
Transcript length (bp)471
Coding sequence length (bp)471
Protein length (aa) 157

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04681 Bys1 Blastomyces yeast-phase-specific protein 3.3E-14 20 155

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4B0F8|TLP1_ARTBC Antigenic thaumatin-like protein ARB_01932 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01932 PE=1 SV=2 17 156 7.0E-34
sp|D4AYB4|TLP2_ARTBC Antigenic thaumatin-like protein ARB_01183 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01183 PE=3 SV=1 21 155 1.0E-11

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5251
MFNKTSILAVGAALVNLASAIGHAKITNSCAFNVTAWSVGSNTAGPYLLTADGGTYDEVLTKDPTTGGRSLKITL
EEDGLYNGKAQTNYAYTLDGDKVWYDLSNVFGDPFKGHKLVVASDNPACPSIVLDDGVPTGKNHVKTCESNSSVT
LTLCAK*
Coding >Hirsu2|5251
ATGTTCAACAAGACCAGCATCCTCGCCGTCGGCGCCGCCCTCGTGAACCTCGCCTCAGCCATCGGCCACGCAAAG
ATCACCAATAGCTGCGCGTTCAACGTCACCGCCTGGTCTGTCGGCTCCAACACCGCCGGCCCCTACCTTCTTACG
GCCGATGGCGGCACCTACGACGAGGTCTTGACCAAGGATCCCACGACCGGCGGTCGGTCTCTCAAGATCACGCTC
GAGGAGGATGGCCTCTACAATGGCAAGGCCCAGACCAACTACGCCTACACCCTCGACGGAGACAAAGTCTGGTAC
GACCTGAGCAACGTGTTTGGCGATCCCTTCAAGGGTCACAAGCTGGTCGTCGCTAGCGACAACCCGGCATGCCCG
TCAATCGTCTTGGATGACGGCGTCCCAACCGGCAAAAACCACGTCAAGACTTGCGAATCGAATTCCAGCGTTACC
CTCACGCTGTGCGCCAAGTGA
Transcript >Hirsu2|5251
ATGTTCAACAAGACCAGCATCCTCGCCGTCGGCGCCGCCCTCGTGAACCTCGCCTCAGCCATCGGCCACGCAAAG
ATCACCAATAGCTGCGCGTTCAACGTCACCGCCTGGTCTGTCGGCTCCAACACCGCCGGCCCCTACCTTCTTACG
GCCGATGGCGGCACCTACGACGAGGTCTTGACCAAGGATCCCACGACCGGCGGTCGGTCTCTCAAGATCACGCTC
GAGGAGGATGGCCTCTACAATGGCAAGGCCCAGACCAACTACGCCTACACCCTCGACGGAGACAAAGTCTGGTAC
GACCTGAGCAACGTGTTTGGCGATCCCTTCAAGGGTCACAAGCTGGTCGTCGCTAGCGACAACCCGGCATGCCCG
TCAATCGTCTTGGATGACGGCGTCCCAACCGGCAAAAACCACGTCAAGACTTGCGAATCGAATTCCAGCGTTACC
CTCACGCTGTGCGCCAAGTGA
Gene >Hirsu2|5251
ATGTTCAACAAGACCAGCATCCTCGCCGTCGGCGCCGCCCTCGTGAACCTCGCCTCAGCCATCGGCCACGCAAAG
ATCACCAATAGCTGCGCGTTCAACGTCACCGCCTGGTCTGTCGGCTCCAACACCGCCGGCCCCTACCTTCTTACG
GCCGATGGCGGCACCTACGACGAGGTCTTGACCAAGGATCCCACGACCGGCGGTCGGTCTCTCAAGATCACGCTC
GAGGAGGATGGCCTCTACAATGGCAAGGCCCAGACCAACTACGCCTACACCCTCGACGGAGACAAAGTCTGGTAC
GACCTGAGCAACGTGTTTGGCGATCCCTTCAAGGGTCACAAGCTGGTCGTCGCTAGCGACAACCCGGCATGCCCG
TCAATCGTCTTGGATGACGGCGTCCCAACCGGCAAAAACCACGTCAAGACTTGCGAATCGAATTCCAGCGTTACC
CTCACGCTGTGCGCCAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail