Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5247
Gene name
LocationContig_262:108..1326
Strand-
Gene length (bp)1218
Transcript length (bp)1119
Coding sequence length (bp)1119
Protein length (aa) 373

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 6.6E-10 84 164
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 6.5E-11 53 347
PF12146 Hydrolase_4 Serine aminopeptidase, S33 1.2E-07 87 169

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|A8IAD8|RUTD_AZOC5 Putative aminoacrylate hydrolase RutD OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=rutD PE=3 SV=1 43 162 5.0E-09
sp|C5CN82|RUTD_VARPS Putative aminoacrylate hydrolase RutD OS=Variovorax paradoxus (strain S110) GN=rutD PE=3 SV=1 50 183 2.0E-08
sp|A0KF11|BIOH_AERHH Pimeloyl-[acyl-carrier protein] methyl ester esterase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=bioH PE=3 SV=1 51 353 2.0E-07

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Mitochondrion Peroxisomal targeting signal 0.6143 0.1403 0.4452 0.151 0.6724 0.2721 0.2401 0.3828 0.2394 0.4225

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3036
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5701
Ophiocordyceps australis map64 (Brazil) OphauB2|7861
Ophiocordyceps camponoti-floridani Ophcf2|02361
Ophiocordyceps camponoti-rufipedis Ophun1|695
Ophiocordyceps kimflemingae Ophio5|4152
Ophiocordyceps subramaniannii Hirsu2|5247 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5247
MSSPATREPSAEETVQHPAYAGAVWALEPDRSGVLSVGAGRRGGPVRIAWEIHGAGPVKVMLLMGVGFTMAGWQR
QTLRLGHDRRARFSVLLLDGRGIGGSDKVTWRPWATSDLARDAAELLDHVGWTGGRAVHVVGISLGGMVAQELAC
LAPERLASLSLVATCACYRDSGALSPSVFAARLRRAFHGGGDAVPDIVRAMCPPDFLAGPDEVVLPDPAATPRCR
PPPGGASSDDGAGGGYRRFRSNFQRLQAEVLTMRRDGVSFSSAGYLGQIVAVLRHRKSRDQLRVMADAVGRRRIL
VVHGTRDSLIPVHNGEALIDVLEPAVGVIVEGLGHAPLIERTQWFNELLEEHFEASAKLDDDSSTPSAAPRL*
Coding >Hirsu2|5247
ATGTCCAGCCCAGCGACGAGGGAGCCGTCGGCGGAGGAGACGGTGCAGCACCCGGCATACGCCGGGGCCGTGTGG
GCGCTCGAGCCGGACCGCAGCGGCGTGCTAAGCGTCGGGGCGGGGCGGCGCGGGGGCCCGGTGCGGATCGCGTGG
GAGATTCACGGCGCCGGGCCCGTCAAGGTCATGCTGCTGATGGGCGTGGGCTTCACCATGGCAGGCTGGCAGCGG
CAGACGCTGCGCCTGGGCCACGACCGGCGCGCCCGCTTCTCCGTCCTGCTGCTGGACGGGCGCGGCATCGGCGGC
AGCGACAAGGTCACGTGGCGGCCGTGGGCGACGAGCGACCTGGCGCGCGACGCGGCCGAGCTGCTGGACCACGTC
GGCTGGACGGGCGGGCGCGCCGTGCACGTCGTCGGCATCTCGCTCGGCGGCATGGTCGCGCAGGAGCTGGCGTGC
CTGGCGCCGGAGCGGCTGGCGTCGCTGTCGCTCGTCGCCACCTGCGCCTGCTACCGGGACTCTGGCGCGCTGTCG
CCATCCGTCTTTGCGGCGAGGCTGCGCCGCGCGTTTCATGGCGGAGGGGACGCCGTCCCGGACATCGTCCGTGCC
ATGTGCCCGCCCGACTTCCTCGCCGGCCCGGACGAGGTCGTCCTGCCCGACCCGGCCGCCACGCCGCGCTGCCGT
CCGCCGCCGGGGGGGGCCTCTTCCGACGACGGCGCCGGGGGCGGGTATCGCCGCTTCCGGTCCAACTTTCAGCGC
CTGCAGGCCGAGGTGCTGACGATGCGCCGCGATGGCGTCAGCTTCTCCTCCGCCGGCTACCTGGGCCAGATCGTC
GCCGTGCTCCGGCACCGCAAGTCCCGGGACCAGCTGCGGGTCATGGCCGACGCCGTCGGCCGCCGGAGGATCCTC
GTCGTGCACGGCACCCGTGACTCTCTCATCCCCGTCCACAACGGCGAGGCCCTCATCGACGTGCTGGAGCCCGCC
GTCGGCGTCATCGTCGAAGGTCTCGGTCACGCTCCGCTTATAGAGCGGACGCAGTGGTTCAACGAGCTGCTGGAG
GAGCACTTCGAGGCATCTGCCAAGCTGGACGACGATTCGTCGACGCCGTCGGCCGCGCCCCGCCTATAG
Transcript >Hirsu2|5247
ATGTCCAGCCCAGCGACGAGGGAGCCGTCGGCGGAGGAGACGGTGCAGCACCCGGCATACGCCGGGGCCGTGTGG
GCGCTCGAGCCGGACCGCAGCGGCGTGCTAAGCGTCGGGGCGGGGCGGCGCGGGGGCCCGGTGCGGATCGCGTGG
GAGATTCACGGCGCCGGGCCCGTCAAGGTCATGCTGCTGATGGGCGTGGGCTTCACCATGGCAGGCTGGCAGCGG
CAGACGCTGCGCCTGGGCCACGACCGGCGCGCCCGCTTCTCCGTCCTGCTGCTGGACGGGCGCGGCATCGGCGGC
AGCGACAAGGTCACGTGGCGGCCGTGGGCGACGAGCGACCTGGCGCGCGACGCGGCCGAGCTGCTGGACCACGTC
GGCTGGACGGGCGGGCGCGCCGTGCACGTCGTCGGCATCTCGCTCGGCGGCATGGTCGCGCAGGAGCTGGCGTGC
CTGGCGCCGGAGCGGCTGGCGTCGCTGTCGCTCGTCGCCACCTGCGCCTGCTACCGGGACTCTGGCGCGCTGTCG
CCATCCGTCTTTGCGGCGAGGCTGCGCCGCGCGTTTCATGGCGGAGGGGACGCCGTCCCGGACATCGTCCGTGCC
ATGTGCCCGCCCGACTTCCTCGCCGGCCCGGACGAGGTCGTCCTGCCCGACCCGGCCGCCACGCCGCGCTGCCGT
CCGCCGCCGGGGGGGGCCTCTTCCGACGACGGCGCCGGGGGCGGGTATCGCCGCTTCCGGTCCAACTTTCAGCGC
CTGCAGGCCGAGGTGCTGACGATGCGCCGCGATGGCGTCAGCTTCTCCTCCGCCGGCTACCTGGGCCAGATCGTC
GCCGTGCTCCGGCACCGCAAGTCCCGGGACCAGCTGCGGGTCATGGCCGACGCCGTCGGCCGCCGGAGGATCCTC
GTCGTGCACGGCACCCGTGACTCTCTCATCCCCGTCCACAACGGCGAGGCCCTCATCGACGTGCTGGAGCCCGCC
GTCGGCGTCATCGTCGAAGGTCTCGGTCACGCTCCGCTTATAGAGCGGACGCAGTGGTTCAACGAGCTGCTGGAG
GAGCACTTCGAGGCATCTGCCAAGCTGGACGACGATTCGTCGACGCCGTCGGCCGCGCCCCGCCTATAG
Gene >Hirsu2|5247
ATGTCCAGCCCAGCGACGAGGGAGCCGTCGGCGGAGGAGACGGTGCAGCACCCGGCATACGCCGGGGCCGTGTGG
GCGCTCGAGCCGGACCGCAGCGGCGTGCTAAGCGTCGGGGCGGGGCGGCGCGGGGGCCCGGTGCGGATCGCGTGG
GAGATTCACGGCGCCGGGCCCGTCAAGGTCATGGTAAGGCGCCCGTCGTCGCCCACACTCCTCCCTTCTTTTTTT
TTCAGTTTTGTCTCGTCGCATCTCTGTCTCTCTCCGCTGACGAGGATGCCGGCCAAGCTGCTGATGGGCGTGGGC
TTCACCATGGCAGGCTGGCAGCGGCAGACGCTGCGCCTGGGCCACGACCGGCGCGCCCGCTTCTCCGTCCTGCTG
CTGGACGGGCGCGGCATCGGCGGCAGCGACAAGGTCACGTGGCGGCCGTGGGCGACGAGCGACCTGGCGCGCGAC
GCGGCCGAGCTGCTGGACCACGTCGGCTGGACGGGCGGGCGCGCCGTGCACGTCGTCGGCATCTCGCTCGGCGGC
ATGGTCGCGCAGGAGCTGGCGTGCCTGGCGCCGGAGCGGCTGGCGTCGCTGTCGCTCGTCGCCACCTGCGCCTGC
TACCGGGACTCTGGCGCGCTGTCGCCATCCGTCTTTGCGGCGAGGCTGCGCCGCGCGTTTCATGGCGGAGGGGAC
GCCGTCCCGGACATCGTCCGTGCCATGTGCCCGCCCGACTTCCTCGCCGGCCCGGACGAGGTCGTCCTGCCCGAC
CCGGCCGCCACGCCGCGCTGCCGTCCGCCGCCGGGGGGGGCCTCTTCCGACGACGGCGCCGGGGGCGGGTATCGC
CGCTTCCGGTCCAACTTTCAGCGCCTGCAGGCCGAGGTGCTGACGATGCGCCGCGATGGCGTCAGCTTCTCCTCC
GCCGGCTACCTGGGCCAGATCGTCGCCGTGCTCCGGCACCGCAAGTCCCGGGACCAGCTGCGGGTCATGGCCGAC
GCCGTCGGCCGCCGGAGGATCCTCGTCGTGCACGGCACCCGTGACTCTCTCATCCCCGTCCACAACGGCGAGGCC
CTCATCGACGTGCTGGAGCCCGCCGTCGGCGTCATCGTCGAAGGTCTCGGTCACGCTCCGCTTATAGAGCGGACG
CAGTGGTTCAACGAGCTGCTGGAGGAGCACTTCGAGGCATCTGCCAAGCTGGACGACGATTCGTCGACGCCGTCG
GCCGCGCCCCGCCTATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail