Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5243
Gene name
LocationContig_2615:1305..1890
Strand-
Gene length (bp)585
Transcript length (bp)585
Coding sequence length (bp)585
Protein length (aa) 195

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00465 Fe-ADH Iron-containing alcohol dehydrogenase 4.1E-09 4 94

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q93T12|TFDF_DELAC Maleylacetate reductase OS=Delftia acidovorans GN=tfdF PE=1 SV=2 5 178 4.0E-17
sp|P27101|TCBF_PSESQ Maleylacetate reductase OS=Pseudomonas sp. (strain P51) GN=tcbF PE=3 SV=1 5 178 4.0E-17
sp|Q45072|TFTE_BURCE Maleylacetate reductase OS=Burkholderia cepacia GN=tftE PE=3 SV=1 5 172 4.0E-16
sp|P27137|TFDF1_CUPPJ Maleylacetate reductase 1 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=tfdFI PE=3 SV=1 4 172 4.0E-15
sp|O84992|MACA1_RHOOP Maleylacetate reductase 1 OS=Rhodococcus opacus GN=macA PE=3 SV=1 5 187 7.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q93T12|TFDF_DELAC Maleylacetate reductase OS=Delftia acidovorans GN=tfdF PE=1 SV=2 5 178 4.0E-17
sp|P27101|TCBF_PSESQ Maleylacetate reductase OS=Pseudomonas sp. (strain P51) GN=tcbF PE=3 SV=1 5 178 4.0E-17
sp|Q45072|TFTE_BURCE Maleylacetate reductase OS=Burkholderia cepacia GN=tftE PE=3 SV=1 5 172 4.0E-16
sp|P27137|TFDF1_CUPPJ Maleylacetate reductase 1 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=tfdFI PE=3 SV=1 4 172 4.0E-15
sp|O84992|MACA1_RHOOP Maleylacetate reductase 1 OS=Rhodococcus opacus GN=macA PE=3 SV=1 5 187 7.0E-15
sp|P94135|TFDF2_CUPPJ Maleylacetate reductase 2 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=tfdFII PE=1 SV=1 5 180 3.0E-14
sp|O30847|CLCE_PSEKB Maleylacetate reductase OS=Pseudomonas knackmussii (strain DSM 6978 / LMG 23759 / B13) GN=clcE PE=3 SV=1 5 180 3.0E-14
sp|O87612|CLCE_PSEAI Maleylacetate reductase OS=Pseudomonas aeruginosa GN=clcE PE=3 SV=1 5 180 4.0E-14
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0008152 metabolic process No
GO:0043169 cation binding No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5243
LLAPLIVSSPSRIALARRIQALIPNLDSRILDSAVVNVPARVVDDALDRISGRDVVISVGGASAVGLAKAIGCRK
GIPHICIPTTYSGSEMMPLLLDASPARHSSSSSSSNSGHSRRHPHASSRRKPTGNTSTVRDPKVLPSVIIYDEEL
TMSAPRRFSAPSDTAAMARSSEFRACPSKSDDTAQWSYIHLPGV*
Coding >Hirsu2|5243
CTGTTGGCGCCTCTCATCGTCTCGAGCCCCTCGCGCATCGCCCTCGCTCGCCGCATCCAAGCCCTCATCCCCAAC
CTCGACTCGCGAATCCTCGACTCGGCCGTCGTCAACGTGCCCGCCCGTGTCGTCGACGACGCCCTGGACCGCATC
TCCGGCCGCGACGTCGTCATCAGCGTGGGCGGAGCCTCCGCCGTCGGTCTCGCAAAGGCCATCGGCTGCCGCAAG
GGCATTCCTCACATCTGCATCCCCACCACCTACTCCGGCTCCGAGATGATGCCCCTTCTCCTCGACGCCAGCCCC
GCCCGCCACAGCAGCAGCAGCAGCAGCAGCAACAGCGGCCACAGCCGCCGCCACCCCCATGCTTCTTCCAGGAGG
AAGCCGACGGGCAACACGAGCACCGTCCGCGACCCCAAGGTCCTGCCCAGCGTCATCATCTACGACGAGGAGCTC
ACCATGAGCGCCCCGAGGCGCTTCTCCGCCCCGTCCGACACTGCCGCCATGGCCCGCTCCTCCGAGTTCCGTGCC
TGCCCGTCCAAGAGCGACGACACCGCGCAGTGGAGTTACATTCATCTGCCTGGCGTCTAA
Transcript >Hirsu2|5243
CTGTTGGCGCCTCTCATCGTCTCGAGCCCCTCGCGCATCGCCCTCGCTCGCCGCATCCAAGCCCTCATCCCCAAC
CTCGACTCGCGAATCCTCGACTCGGCCGTCGTCAACGTGCCCGCCCGTGTCGTCGACGACGCCCTGGACCGCATC
TCCGGCCGCGACGTCGTCATCAGCGTGGGCGGAGCCTCCGCCGTCGGTCTCGCAAAGGCCATCGGCTGCCGCAAG
GGCATTCCTCACATCTGCATCCCCACCACCTACTCCGGCTCCGAGATGATGCCCCTTCTCCTCGACGCCAGCCCC
GCCCGCCACAGCAGCAGCAGCAGCAGCAGCAACAGCGGCCACAGCCGCCGCCACCCCCATGCTTCTTCCAGGAGG
AAGCCGACGGGCAACACGAGCACCGTCCGCGACCCCAAGGTCCTGCCCAGCGTCATCATCTACGACGAGGAGCTC
ACCATGAGCGCCCCGAGGCGCTTCTCCGCCCCGTCCGACACTGCCGCCATGGCCCGCTCCTCCGAGTTCCGTGCC
TGCCCGTCCAAGAGCGACGACACCGCGCAGTGGAGTTACATTCATCTGCCTGGCGTCTAA
Gene >Hirsu2|5243
CTGTTGGCGCCTCTCATCGTCTCGAGCCCCTCGCGCATCGCCCTCGCTCGCCGCATCCAAGCCCTCATCCCCAAC
CTCGACTCGCGAATCCTCGACTCGGCCGTCGTCAACGTGCCCGCCCGTGTCGTCGACGACGCCCTGGACCGCATC
TCCGGCCGCGACGTCGTCATCAGCGTGGGCGGAGCCTCCGCCGTCGGTCTCGCAAAGGCCATCGGCTGCCGCAAG
GGCATTCCTCACATCTGCATCCCCACCACCTACTCCGGCTCCGAGATGATGCCCCTTCTCCTCGACGCCAGCCCC
GCCCGCCACAGCAGCAGCAGCAGCAGCAGCAACAGCGGCCACAGCCGCCGCCACCCCCATGCTTCTTCCAGGAGG
AAGCCGACGGGCAACACGAGCACCGTCCGCGACCCCAAGGTCCTGCCCAGCGTCATCATCTACGACGAGGAGCTC
ACCATGAGCGCCCCGAGGCGCTTCTCCGCCCCGTCCGACACTGCCGCCATGGCCCGCTCCTCCGAGTTCCGTGCC
TGCCCGTCCAAGAGCGACGACACCGCGCAGTGGAGTTACATTCATCTGCCTGGCGTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail