Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5241
Gene name
LocationContig_2614:28..442
Strand+
Gene length (bp)414
Transcript length (bp)414
Coding sequence length (bp)414
Protein length (aa) 138

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07859 Abhydrolase_3 alpha/beta hydrolase fold 1.5E-20 2 110

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9US38|YFZ3_SCHPO AB hydrolase superfamily protein C1039.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.03 PE=3 SV=1 9 120 4.0E-26
sp|Q5UQ83|YR526_MIMIV Putative alpha/beta hydrolase R526 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R526 PE=1 SV=1 2 113 1.0E-07

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6242 0.4492 0.0598 0.1415 0.3629 0.1274 0.0806 0.2727 0.3515 0.0174

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3034
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7051
Ophiocordyceps australis map64 (Brazil) OphauB2|4574
Ophiocordyceps camponoti-floridani Ophcf2|01658
Ophiocordyceps camponoti-rufipedis Ophun1|1301
Ophiocordyceps kimflemingae Ophio5|3691
Ophiocordyceps subramaniannii Hirsu2|5241 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5241
LQLLSVPVVDNTADPSNNVSYAENEFAPALPADKMLWYRRHYLPDPADWPHPEASPLFWPGDWAALPPAVVVLGE
LDVLRHEGQLFARRLADAGVATALHVLKGQPHPFLAMDGALDDGRRAITWFCEAMYNVMYAS*
Coding >Hirsu2|5241
CTGCAGCTGCTGTCGGTGCCGGTCGTCGACAACACGGCCGACCCGAGCAACAACGTGTCGTACGCCGAGAACGAG
TTCGCGCCGGCGCTGCCGGCCGACAAGATGCTGTGGTACCGCCGCCACTACCTGCCGGACCCGGCCGACTGGCCG
CACCCCGAGGCCAGCCCGCTCTTCTGGCCCGGCGACTGGGCCGCCCTGCCGCCGGCCGTCGTCGTCCTCGGCGAG
CTCGACGTTCTGCGCCACGAGGGCCAGCTGTTCGCCCGCCGCCTCGCCGACGCCGGCGTCGCCACCGCCCTGCAC
GTCCTCAAGGGCCAGCCGCACCCCTTCCTCGCCATGGACGGCGCCCTCGACGACGGCCGCCGCGCCATCACCTGG
TTCTGCGAGGCCATGTACAACGTCATGTACGCATCATGA
Transcript >Hirsu2|5241
CTGCAGCTGCTGTCGGTGCCGGTCGTCGACAACACGGCCGACCCGAGCAACAACGTGTCGTACGCCGAGAACGAG
TTCGCGCCGGCGCTGCCGGCCGACAAGATGCTGTGGTACCGCCGCCACTACCTGCCGGACCCGGCCGACTGGCCG
CACCCCGAGGCCAGCCCGCTCTTCTGGCCCGGCGACTGGGCCGCCCTGCCGCCGGCCGTCGTCGTCCTCGGCGAG
CTCGACGTTCTGCGCCACGAGGGCCAGCTGTTCGCCCGCCGCCTCGCCGACGCCGGCGTCGCCACCGCCCTGCAC
GTCCTCAAGGGCCAGCCGCACCCCTTCCTCGCCATGGACGGCGCCCTCGACGACGGCCGCCGCGCCATCACCTGG
TTCTGCGAGGCCATGTACAACGTCATGTACGCATCATGA
Gene >Hirsu2|5241
CTGCAGCTGCTGTCGGTGCCGGTCGTCGACAACACGGCCGACCCGAGCAACAACGTGTCGTACGCCGAGAACGAG
TTCGCGCCGGCGCTGCCGGCCGACAAGATGCTGTGGTACCGCCGCCACTACCTGCCGGACCCGGCCGACTGGCCG
CACCCCGAGGCCAGCCCGCTCTTCTGGCCCGGCGACTGGGCCGCCCTGCCGCCGGCCGTCGTCGTCCTCGGCGAG
CTCGACGTTCTGCGCCACGAGGGCCAGCTGTTCGCCCGCCGCCTCGCCGACGCCGGCGTCGCCACCGCCCTGCAC
GTCCTCAAGGGCCAGCCGCACCCCTTCCTCGCCATGGACGGCGCCCTCGACGACGGCCGCCGCGCCATCACCTGG
TTCTGCGAGGCCATGTACAACGTCATGTACGCATCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail