Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5234
Gene name
LocationContig_261:22748..23756
Strand-
Gene length (bp)1008
Transcript length (bp)789
Coding sequence length (bp)789
Protein length (aa) 263

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00227 Proteasome Proteasome subunit 2.4E-30 39 230

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USQ9|PSB7_SCHPO Probable proteasome subunit beta type-7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC577.10 PE=3 SV=1 6 262 3.0E-84
sp|P30657|PSB7_YEAST Proteasome subunit beta type-7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE4 PE=1 SV=1 1 262 1.0E-82
sp|P99026|PSB4_MOUSE Proteasome subunit beta type-4 OS=Mus musculus GN=Psmb4 PE=1 SV=1 26 257 1.0E-58
sp|P28024|PSB4_XENLA Proteasome subunit beta type-4 (Fragment) OS=Xenopus laevis GN=psmb4 PE=2 SV=2 26 257 2.0E-58
sp|Q3T108|PSB4_BOVIN Proteasome subunit beta type-4 OS=Bos taurus GN=PSMB4 PE=1 SV=1 30 257 2.0E-58
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USQ9|PSB7_SCHPO Probable proteasome subunit beta type-7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC577.10 PE=3 SV=1 6 262 3.0E-84
sp|P30657|PSB7_YEAST Proteasome subunit beta type-7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE4 PE=1 SV=1 1 262 1.0E-82
sp|P99026|PSB4_MOUSE Proteasome subunit beta type-4 OS=Mus musculus GN=Psmb4 PE=1 SV=1 26 257 1.0E-58
sp|P28024|PSB4_XENLA Proteasome subunit beta type-4 (Fragment) OS=Xenopus laevis GN=psmb4 PE=2 SV=2 26 257 2.0E-58
sp|Q3T108|PSB4_BOVIN Proteasome subunit beta type-4 OS=Bos taurus GN=PSMB4 PE=1 SV=1 30 257 2.0E-58
sp|P28070|PSB4_HUMAN Proteasome subunit beta type-4 OS=Homo sapiens GN=PSMB4 PE=1 SV=4 22 257 2.0E-58
sp|Q556Q0|PSB4_DICDI Proteasome subunit beta type-4 OS=Dictyostelium discoideum GN=psmB4-1 PE=3 SV=1 25 252 2.0E-55
sp|P34067|PSB4_RAT Proteasome subunit beta type-4 OS=Rattus norvegicus GN=Psmb4 PE=1 SV=2 30 257 5.0E-55
sp|Q7DLR9|PSB4_ARATH Proteasome subunit beta type-4 OS=Arabidopsis thaliana GN=PBG1 PE=1 SV=2 32 251 5.0E-47
sp|Q9VNA5|PSB4_DROME Proteasome subunit beta type-4 OS=Drosophila melanogaster GN=Prosbeta7 PE=2 SV=1 44 257 2.0E-41
sp|Q8SS01|PSB7_ENCCU Probable proteasome subunit beta type-7 OS=Encephalitozoon cuniculi (strain GB-M1) GN=PRE4 PE=1 SV=2 39 253 1.0E-30
sp|Q29384|PSB4_PIG Proteasome subunit beta type-4 (Fragment) OS=Sus scrofa GN=PSMB4 PE=2 SV=1 30 142 8.0E-24
sp|B1L6S7|PSB1_KORCO Proteasome subunit beta 1 OS=Korarchaeum cryptofilum (strain OPF8) GN=psmB1 PE=3 SV=1 38 243 4.0E-15
sp|C5A2D5|PSB2_THEGJ Proteasome subunit beta 2 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=psmB2 PE=3 SV=1 40 235 4.0E-13
sp|D4GYZ1|PSB_HALVD Proteasome subunit beta OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=psmB PE=1 SV=1 12 238 5.0E-13
sp|A7I841|PSB_METB6 Proteasome subunit beta OS=Methanoregula boonei (strain 6A8) GN=psmB PE=3 SV=1 36 246 8.0E-13
sp|Q8ZST5|PSB2_PYRAE Proteasome subunit beta 2 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=psmB2 PE=3 SV=1 36 234 2.0E-12
sp|Q2FQL8|PSB_METHJ Proteasome subunit beta OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=psmB PE=3 SV=1 35 243 3.0E-12
sp|Q74MP5|PSB_NANEQ Proteasome subunit beta OS=Nanoarchaeum equitans (strain Kin4-M) GN=psmB PE=3 SV=1 42 236 3.0E-12
sp|C6A3R1|PSB2_THESM Proteasome subunit beta 2 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=psmB2 PE=3 SV=1 40 235 4.0E-12
sp|A6VK02|PSB_METM7 Proteasome subunit beta OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=psmB PE=3 SV=1 41 255 6.0E-12
sp|A9A788|PSB_METM6 Proteasome subunit beta OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=psmB PE=3 SV=1 41 255 6.0E-12
sp|A9A4A1|PSB1_NITMS Proteasome subunit beta 1 OS=Nitrosopumilus maritimus (strain SCM1) GN=psmB1 PE=3 SV=1 41 241 9.0E-12
sp|D3S8M7|PSB_METSF Proteasome subunit beta OS=Methanocaldococcus sp. (strain FS406-22) GN=psmB PE=3 SV=1 38 245 1.0E-11
sp|B8GG66|PSB_METPE Proteasome subunit beta OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=psmB PE=3 SV=1 34 250 1.0E-11
sp|C7P6N4|PSB_METFA Proteasome subunit beta OS=Methanocaldococcus fervens (strain DSM 4213 / JCM 157852 / AG86) GN=psmB PE=3 SV=1 38 245 1.0E-11
sp|A2SS78|PSB_METLZ Proteasome subunit beta OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=psmB PE=3 SV=1 35 243 1.0E-11
sp|Q18GX3|PSB_HALWD Proteasome subunit beta OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=psmB PE=3 SV=1 4 245 1.0E-11
sp|A3DN21|PSB1_STAMF Proteasome subunit beta 1 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=psmB1 PE=3 SV=1 43 239 1.0E-11
sp|A3MXQ6|PSB2_PYRCJ Proteasome subunit beta 2 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=psmB2 PE=3 SV=1 36 234 2.0E-11
sp|B9LTS6|PSB_HALLT Proteasome subunit beta OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=psmB PE=3 SV=1 15 237 2.0E-11
sp|A6USJ3|PSB_METVS Proteasome subunit beta OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=psmB PE=3 SV=1 41 244 2.0E-11
sp|Q8U4C9|PSB1_PYRFU Proteasome subunit beta 1 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=psmB1 PE=3 SV=1 40 235 2.0E-11
sp|Q58634|PSB_METJA Proteasome subunit beta OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=psmB PE=1 SV=1 38 245 2.0E-11
sp|O50110|PSB2_PYRHO Proteasome subunit beta 2 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=psmB2 PE=3 SV=1 41 244 5.0E-11
sp|C9REN7|PSB_METVM Proteasome subunit beta OS=Methanocaldococcus vulcanius (strain ATCC 700851 / DSM 12094 / M7) GN=psmB PE=3 SV=1 41 245 5.0E-11
sp|Q8U125|PSB2_PYRFU Proteasome subunit beta 2 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=psmB2 PE=3 SV=1 41 234 5.0E-11
sp|A9A2U7|PSB2_NITMS Proteasome subunit beta 2 OS=Nitrosopumilus maritimus (strain SCM1) GN=psmB2 PE=3 SV=1 32 242 6.0E-11
sp|A4FYA5|PSB_METM5 Proteasome subunit beta OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=psmB PE=3 SV=1 41 255 9.0E-11
sp|Q32KL2|PSB5_BOVIN Proteasome subunit beta type-5 OS=Bos taurus GN=PSMB5 PE=1 SV=1 9 244 9.0E-11
sp|Q9YES4|PSB1_AERPE Proteasome subunit beta 1 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=psmB1 PE=3 SV=2 41 234 1.0E-10
sp|Q4JAA8|PSB2_SULAC Proteasome subunit beta 2 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=psmB2 PE=3 SV=1 33 234 2.0E-10
sp|D2RGT4|PSB_ARCPA Proteasome subunit beta OS=Archaeoglobus profundus (strain DSM 5631 / JCM 9629 / NBRC 100127 / Av18) GN=psmB PE=3 SV=1 33 245 3.0E-10
sp|A1RSJ8|PSB1_PYRIL Proteasome subunit beta 1 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=psmB1 PE=3 SV=1 36 234 3.0E-10
sp|Q9YER0|PSB2_AERPE Proteasome subunit beta 2 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=psmB2 PE=3 SV=2 40 234 3.0E-10
sp|Q5JHL8|PSB2_THEKO Proteasome subunit beta 2 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=psmB2 PE=3 SV=1 40 235 4.0E-10
sp|Q9V0N9|PSB2_PYRAB Proteasome subunit beta 2 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=psmB2 PE=3 SV=1 41 243 4.0E-10
sp|A3CUS9|PSB_METMJ Proteasome subunit beta OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=psmB PE=3 SV=1 33 249 5.0E-10
sp|Q9V247|PSB1_PYRAB Proteasome subunit beta 1 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=psmB1 PE=3 SV=1 40 235 5.0E-10
sp|B1YDJ0|PSB2_PYRNV Proteasome subunit beta 2 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=psmB2 PE=3 SV=1 40 241 5.0E-10
sp|O57983|PSB1_PYRHO Proteasome subunit beta 1 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=psmB1 PE=3 SV=1 40 235 9.0E-10
sp|Q6LZD4|PSB_METMP Proteasome subunit beta OS=Methanococcus maripaludis (strain S2 / LL) GN=psmB PE=3 SV=1 41 244 9.0E-10
sp|Q5R8S2|PSB5_PONAB Proteasome subunit beta type-5 OS=Pongo abelii GN=PSMB5 PE=2 SV=3 22 244 1.0E-09
sp|P28074|PSB5_HUMAN Proteasome subunit beta type-5 OS=Homo sapiens GN=PSMB5 PE=1 SV=3 22 244 1.0E-09
sp|Q975D1|PSB2_SULTO Proteasome subunit beta 2 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=psmB2 PE=3 SV=1 32 234 1.0E-09
sp|A6UT20|PSB_META3 Proteasome subunit beta OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=psmB PE=3 SV=1 41 247 1.0E-09
sp|A5UM14|PSB_METS3 Proteasome subunit beta OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=psmB PE=3 SV=1 37 244 2.0E-09
sp|B8D673|PSB1_DESK1 Proteasome subunit beta 1 OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=psmB1 PE=3 SV=1 36 234 4.0E-09
sp|A8AA46|PSB1_IGNH4 Proteasome subunit beta 1 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=psmB1 PE=3 SV=1 41 234 6.0E-09
sp|A4WMZ0|PSB2_PYRAR Proteasome subunit beta 2 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=psmB2 PE=3 SV=1 36 185 6.0E-09
sp|C3NHF1|PSB2_SULIN Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=psmB2 PE=3 SV=1 29 194 6.0E-09
sp|A2BN27|PSB2_HYPBU Proteasome subunit beta 2 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=psmB2 PE=3 SV=1 41 233 7.0E-09
sp|A8AB58|PSB2_IGNH4 Proteasome subunit beta 2 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=psmB2 PE=3 SV=1 41 238 9.0E-09
sp|Q86A21|PSB1_DICDI Proteasome subunit beta type-1 OS=Dictyostelium discoideum GN=psmB1 PE=3 SV=1 30 244 9.0E-09
sp|C3NE98|PSB1_SULIY Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=psmB1 PE=3 SV=1 29 194 1.0E-08
sp|C3MVD5|PSB1_SULIM Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=psmB1 PE=3 SV=1 29 194 1.0E-08
sp|C3MQ16|PSB1_SULIL Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=psmB1 PE=3 SV=1 29 194 1.0E-08
sp|C4KHB0|PSB1_SULIK Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=psmB1 PE=3 SV=1 29 194 1.0E-08
sp|D2PK63|PSB1_SULID Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain L.D.8.5 / Lassen #2) GN=psmB1 PE=3 SV=1 29 194 1.0E-08
sp|C3N5N4|PSB1_SULIA Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain M.16.27) GN=psmB1 PE=3 SV=1 29 194 1.0E-08
sp|B6YSW2|PSB1_THEON Proteasome subunit beta 1 OS=Thermococcus onnurineus (strain NA1) GN=psmB1 PE=3 SV=1 41 234 1.0E-08
sp|P28075|PSB5_RAT Proteasome subunit beta type-5 OS=Rattus norvegicus GN=Psmb5 PE=1 SV=3 9 244 1.0E-08
sp|Q5W416|PSB8_CANLF Proteasome subunit beta type-8 OS=Canis lupus familiaris GN=PSMB8 PE=1 SV=1 31 234 1.0E-08
sp|Q9P996|PSB_ARCFU Proteasome subunit beta OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=psmB PE=1 SV=1 35 233 1.0E-08
sp|O55234|PSB5_MOUSE Proteasome subunit beta type-5 OS=Mus musculus GN=Psmb5 PE=1 SV=3 9 244 1.0E-08
sp|A0RXV1|PSB2_CENSY Proteasome subunit beta 2 OS=Cenarchaeum symbiosum (strain A) GN=psmB2 PE=3 SV=2 32 242 2.0E-08
sp|A0RU86|PSB1_CENSY Proteasome subunit beta 1 OS=Cenarchaeum symbiosum (strain A) GN=psmB1 PE=3 SV=1 41 185 2.0E-08
sp|P40304|PSB1_DROME Proteasome subunit beta type-1 OS=Drosophila melanogaster GN=Prosbeta6 PE=2 SV=2 41 239 4.0E-08
sp|D0KTH0|PSB2_SULS9 Proteasome subunit beta 2 OS=Sulfolobus solfataricus (strain 98/2) GN=psmB2 PE=3 SV=2 29 194 4.0E-08
sp|Q9UXF3|PSB2_SULSO Proteasome subunit beta 2 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=psmB2 PE=3 SV=2 29 194 4.0E-08
sp|B6YXV3|PSB2_THEON Proteasome subunit beta 2 OS=Thermococcus onnurineus (strain NA1) GN=psmB2 PE=3 SV=1 47 235 5.0E-08
sp|Q09841|PSB2_SCHPO Probable proteasome subunit beta type-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pup1 PE=2 SV=1 19 247 9.0E-08
sp|Q8TW10|PSB_METKA Proteasome subunit beta OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=psmB PE=3 SV=1 38 233 9.0E-08
sp|Q4JAY3|PSB1_SULAC Proteasome subunit beta 1 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=psmB1 PE=3 SV=1 43 235 1.0E-07
sp|O82531|PSB1_PETHY Proteasome subunit beta type-1 OS=Petunia hybrida GN=PBF1 PE=2 SV=1 25 240 1.0E-07
sp|O64464|PSB1_ORYSJ Proteasome subunit beta type-1 OS=Oryza sativa subsp. japonica GN=PBF1 PE=2 SV=1 40 240 2.0E-07
sp|A2BN24|PSB1_HYPBU Proteasome subunit beta 1 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=psmB1 PE=3 SV=1 40 242 4.0E-07
sp|C3N7K2|PSB2_SULIY Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=psmB2 PE=3 SV=1 43 234 4.0E-07
sp|C3MY41|PSB2_SULIM Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=psmB2 PE=3 SV=1 43 234 4.0E-07
sp|C3MRE5|PSB2_SULIL Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=psmB2 PE=3 SV=1 43 234 4.0E-07
sp|C4KIR0|PSB2_SULIK Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=psmB2 PE=3 SV=1 43 234 4.0E-07
sp|D2PDG6|PSB2_SULID Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain L.D.8.5 / Lassen #2) GN=psmB2 PE=3 SV=1 43 234 4.0E-07
sp|C3MZI0|PSB2_SULIA Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain M.16.27) GN=psmB2 PE=3 SV=1 43 234 4.0E-07
sp|C3NFX2|PSB1_SULIN Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=psmB1 PE=3 SV=1 43 234 4.0E-07
sp|P42742|PSB1_ARATH Proteasome subunit beta type-1 OS=Arabidopsis thaliana GN=PBF1 PE=1 SV=2 40 240 5.0E-07
sp|A1RX71|PSB2_THEPD Proteasome subunit beta 2 OS=Thermofilum pendens (strain Hrk 5) GN=psmB2 PE=3 SV=1 38 234 1.0E-06
sp|Q9IB83|PSB1B_CARAU Proteasome subunit beta type-1-B OS=Carassius auratus GN=psmb1-B PE=2 SV=1 29 235 1.0E-06
sp|Q9N9W8|PSB3_GIAIN Proteasome subunit beta type-3 OS=Giardia intestinalis GN=PRSBETA3 PE=2 SV=1 40 244 1.0E-06
sp|Q9IB84|PSB1A_CARAU Proteasome subunit beta type-1-A OS=Carassius auratus GN=psmb1-A PE=2 SV=1 29 235 1.0E-06
sp|O27270|PSB_METTH Proteasome subunit beta OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=psmB PE=3 SV=1 41 246 1.0E-06
sp|D3E0A3|PSB_METRM Proteasome subunit beta OS=Methanobrevibacter ruminantium (strain ATCC 35063 / DSM 1093 / JCM 13430 / OCM 146 / M1) GN=psmB PE=3 SV=1 41 255 1.0E-06
sp|P20618|PSB1_HUMAN Proteasome subunit beta type-1 OS=Homo sapiens GN=PSMB1 PE=1 SV=2 24 235 2.0E-06
sp|P25043|PSB2_YEAST Proteasome subunit beta type-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUP1 PE=1 SV=1 22 250 2.0E-06
sp|Q980L4|PSB1_SULSO Proteasome subunit beta 1 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=psmB1 PE=3 SV=1 43 234 2.0E-06
sp|D0KRX1|PSB1_SULS9 Proteasome subunit beta 1 OS=Sulfolobus solfataricus (strain 98/2) GN=psmB1 PE=3 SV=1 43 234 2.0E-06
sp|B5IEE5|PSB_ACIB4 Proteasome subunit beta OS=Aciduliprofundum boonei (strain DSM 19572 / T469) GN=psmB PE=3 SV=1 50 246 2.0E-06
sp|P28061|PSB_THEAC Proteasome subunit beta OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=psmB PE=1 SV=1 35 241 2.0E-06
sp|O24361|PSB5_SPIOL Proteasome subunit beta type-5 OS=Spinacia oleracea PE=2 SV=1 41 234 2.0E-06
sp|C6A2V9|PSB1_THESM Proteasome subunit beta 1 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=psmB1 PE=3 SV=1 39 245 3.0E-06
sp|Q99436|PSB7_HUMAN Proteasome subunit beta type-7 OS=Homo sapiens GN=PSMB7 PE=1 SV=1 40 237 3.0E-06
sp|Q9R1P3|PSB2_MOUSE Proteasome subunit beta type-2 OS=Mus musculus GN=Psmb2 PE=1 SV=1 44 235 4.0E-06
sp|Q12YV7|PSB_METBU Proteasome subunit beta OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=psmB PE=3 SV=1 41 247 4.0E-06
sp|P18421|PSB1_RAT Proteasome subunit beta type-1 OS=Rattus norvegicus GN=Psmb1 PE=1 SV=3 12 235 4.0E-06
sp|P40307|PSB2_RAT Proteasome subunit beta type-2 OS=Rattus norvegicus GN=Psmb2 PE=1 SV=1 44 247 4.0E-06
sp|A3DN27|PSB2_STAMF Proteasome subunit beta 2 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=psmB2 PE=3 SV=1 36 188 5.0E-06
sp|Q5E9K0|PSB2_BOVIN Proteasome subunit beta type-2 OS=Bos taurus GN=PSMB2 PE=1 SV=1 44 235 5.0E-06
sp|A8M8R5|PSB2_CALMQ Proteasome subunit beta 2 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=psmB2 PE=3 SV=1 35 234 6.0E-06
sp|Q2TBP0|PSB7_BOVIN Proteasome subunit beta type-7 OS=Bos taurus GN=PSMB7 PE=1 SV=1 40 237 7.0E-06
sp|P70195|PSB7_MOUSE Proteasome subunit beta type-7 OS=Mus musculus GN=Psmb7 PE=1 SV=1 40 237 7.0E-06
sp|Q9JHW0|PSB7_RAT Proteasome subunit beta type-7 OS=Rattus norvegicus GN=Psmb7 PE=1 SV=1 40 237 8.0E-06
sp|Q2TBX6|PSB1_BOVIN Proteasome subunit beta type-1 OS=Bos taurus GN=PSMB1 PE=1 SV=1 24 235 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005839 proteasome core complex Yes
GO:0051603 proteolysis involved in cellular protein catabolic process Yes
GO:0004298 threonine-type endopeptidase activity Yes
GO:0070011 peptidase activity, acting on L-amino acid peptides No
GO:0005575 cellular_component No
GO:0006508 proteolysis No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0044238 primary metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0004175 endopeptidase activity No
GO:0071704 organic substance metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0070003 threonine-type peptidase activity No
GO:0043170 macromolecule metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0008233 peptidase activity No
GO:0044464 cell part No
GO:0019538 protein metabolic process No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0044424 intracellular part No
GO:0032991 protein-containing complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5234
MDHRPQAWGRPRDDIYGPYDASYMQPNHGPKQNTQQPIVTGTSVVALKFKDGVVMAADNLASYGSLARFTDVKRL
RPFAGSSVVGFSGDVSDMQYLDRHLTDLALQEAYDSPDRPRLSAANLHRYLAKLLYRRRSKFDPLWNQLLVAGFD
DAGEPFLAAADLLGSTYAAPSLATGFGAMLAQPIMRRHAPDEAAARALDRDQAVAVVRECMRVLFYRDARSLDRY
SLAVVTRDGVDLRSDERLDKQSWAFAERIRGYGTQTV*
Coding >Hirsu2|5234
ATGGATCACCGTCCGCAAGCCTGGGGCCGACCCAGAGACGACATCTACGGCCCCTATGACGCCTCGTACATGCAG
CCGAATCACGGCCCCAAGCAGAATACGCAGCAGCCCATCGTGACCGGCACCTCGGTCGTGGCCCTCAAGTTCAAG
GACGGCGTCGTCATGGCCGCCGACAACCTCGCCTCGTACGGCTCGCTCGCGCGCTTCACCGACGTCAAGCGCCTG
CGCCCCTTCGCCGGCTCCTCCGTCGTCGGCTTCTCGGGCGACGTGTCGGACATGCAGTACCTGGACCGGCACCTG
ACGGACCTGGCGCTGCAGGAGGCCTACGACTCGCCCGACCGGCCGCGCCTGTCGGCCGCCAACCTGCACCGCTAC
CTGGCCAAGCTGCTGTACCGCCGCCGCTCCAAGTTCGACCCGCTGTGGAACCAGCTGCTGGTGGCGGGCTTCGAC
GACGCCGGCGAGCCCTTCCTCGCCGCCGCCGACCTGCTCGGCTCCACGTACGCGGCCCCGAGCCTGGCCACCGGC
TTCGGCGCCATGCTCGCCCAGCCCATCATGCGCCGCCACGCGCCCGACGAGGCCGCCGCCCGCGCCCTCGACCGC
GACCAGGCCGTCGCCGTCGTCCGCGAGTGCATGCGCGTCCTCTTCTATCGCGACGCCCGCAGCCTCGACCGCTAC
TCCCTCGCCGTCGTCACCCGCGACGGCGTCGACCTCCGCTCCGACGAGCGCCTCGACAAGCAGAGCTGGGCCTTT
GCCGAGCGCATCCGCGGCTACGGCACCCAGACCGTCTGA
Transcript >Hirsu2|5234
ATGGATCACCGTCCGCAAGCCTGGGGCCGACCCAGAGACGACATCTACGGCCCCTATGACGCCTCGTACATGCAG
CCGAATCACGGCCCCAAGCAGAATACGCAGCAGCCCATCGTGACCGGCACCTCGGTCGTGGCCCTCAAGTTCAAG
GACGGCGTCGTCATGGCCGCCGACAACCTCGCCTCGTACGGCTCGCTCGCGCGCTTCACCGACGTCAAGCGCCTG
CGCCCCTTCGCCGGCTCCTCCGTCGTCGGCTTCTCGGGCGACGTGTCGGACATGCAGTACCTGGACCGGCACCTG
ACGGACCTGGCGCTGCAGGAGGCCTACGACTCGCCCGACCGGCCGCGCCTGTCGGCCGCCAACCTGCACCGCTAC
CTGGCCAAGCTGCTGTACCGCCGCCGCTCCAAGTTCGACCCGCTGTGGAACCAGCTGCTGGTGGCGGGCTTCGAC
GACGCCGGCGAGCCCTTCCTCGCCGCCGCCGACCTGCTCGGCTCCACGTACGCGGCCCCGAGCCTGGCCACCGGC
TTCGGCGCCATGCTCGCCCAGCCCATCATGCGCCGCCACGCGCCCGACGAGGCCGCCGCCCGCGCCCTCGACCGC
GACCAGGCCGTCGCCGTCGTCCGCGAGTGCATGCGCGTCCTCTTCTATCGCGACGCCCGCAGCCTCGACCGCTAC
TCCCTCGCCGTCGTCACCCGCGACGGCGTCGACCTCCGCTCCGACGAGCGCCTCGACAAGCAGAGCTGGGCCTTT
GCCGAGCGCATCCGCGGCTACGGCACCCAGACCGTCTGA
Gene >Hirsu2|5234
ATGGATCACCGTCCGCAAGCCTGGGGCCGAGTGCGTCGTCCCTCGAGATCCGCCCGACGATGGAAGGGCAGCCAA
TTGCTGACGTGGAAGCAACGACGCGCGACAGCCCAGAGACGACATCTACGGCCCCTATGACGCCTCGTACATGCA
GCCGAATCACGGCCCCAAGCAGAATACGCAGCAGCCCATCGTGACCGGCACCTCGGTCGTGGCCCTCAAGTTCAA
GGACGGCGTCGTCATGGCCGCCGACAACCTCGGTTCGTCTCCCCCCTTTCCCCCTTCTTCCTCAGCCAGAGAGAG
AGTGTGTGTGTGTGTGTGTATGTTAGGGGAAGAAAGAGAGAGTGTGTGTATGTGTGAGTGAGCGAAGAGAAGAGA
AGCGCTGACGCATATCCTCCCCCAGCCTCGTACGGCTCGCTCGCGCGCTTCACCGACGTCAAGCGCCTGCGCCCC
TTCGCCGGCTCCTCCGTCGTCGGCTTCTCGGGCGACGTGTCGGACATGCAGTACCTGGACCGGCACCTGACGGAC
CTGGCGCTGCAGGAGGCCTACGACTCGCCCGACCGGCCGCGCCTGTCGGCCGCCAACCTGCACCGCTACCTGGCC
AAGCTGCTGTACCGCCGCCGCTCCAAGTTCGACCCGCTGTGGAACCAGCTGCTGGTGGCGGGCTTCGACGACGCC
GGCGAGCCCTTCCTCGCCGCCGCCGACCTGCTCGGCTCCACGTACGCGGCCCCGAGCCTGGCCACCGGCTTCGGC
GCCATGCTCGCCCAGCCCATCATGCGCCGCCACGCGCCCGACGAGGCCGCCGCCCGCGCCCTCGACCGCGACCAG
GCCGTCGCCGTCGTCCGCGAGTGCATGCGCGTCCTCTTCTATCGCGACGCCCGCAGCCTCGACCGCTACTCCCTC
GCCGTCGTCACCCGCGACGGCGTCGACCTCCGCTCCGACGAGCGCCTCGACAAGCAGAGCTGGGCCTTTGCCGAG
CGCATCCGCGGCTACGGCACCCAGACCGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail