Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5231
Gene name
LocationContig_261:13126..13753
Strand+
Gene length (bp)627
Transcript length (bp)627
Coding sequence length (bp)627
Protein length (aa) 209

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09282 Mago-bind Mago binding 2.5E-14 18 44

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q640E9|WIBG_XENLA Partner of Y14 and mago OS=Xenopus laevis GN=wibg PE=2 SV=1 20 186 3.0E-11
sp|Q8CHP5|WIBG_MOUSE Partner of Y14 and mago OS=Mus musculus GN=Wibg PE=1 SV=2 13 170 3.0E-10
sp|B1WB17|WIBG_XENTR Partner of Y14 and mago OS=Xenopus tropicalis GN=wibg PE=2 SV=1 11 170 7.0E-10
sp|Q6PH11|WIBG_DANRE Partner of Y14 and mago OS=Danio rerio GN=wibg PE=2 SV=1 11 183 2.0E-09
sp|P53235|EIF2A_YEAST Eukaryotic translation initiation factor 2A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGR054W PE=1 SV=1 20 188 1.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 66 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5231
MSSSPATNSGIVTDEGSGQRHIPESVRADGSTRKAIKIRPGYRPPEDVEVYKNRTAEAFRDRGKKAGIPGAAGLQ
PEQGASASSSSSKNAKRREARKKAAKAAADGDDLGGDDQGGQPDVARPPKTEEADPEVEREKKARNLRKKLKQAR
DLQSKKEGGETLLPEQIAKVIKINELIRELNALGLDDEQEAKAGPDASRAPSGTSGRD*
Coding >Hirsu2|5231
ATGTCTTCCTCCCCCGCCACCAACTCGGGCATCGTCACCGACGAGGGCAGCGGACAGCGCCACATCCCCGAGTCG
GTCCGGGCCGACGGCAGCACTCGCAAGGCCATCAAGATCCGCCCGGGCTACCGCCCGCCCGAGGACGTCGAGGTC
TACAAGAACCGCACCGCCGAGGCGTTCCGCGACCGCGGCAAGAAGGCGGGCATCCCCGGCGCCGCCGGCCTCCAG
CCGGAGCAGGGCGCCTCGGCGAGCAGCAGCAGCAGCAAGAACGCCAAGAGACGGGAGGCGCGTAAGAAGGCTGCC
AAGGCCGCGGCCGACGGCGACGACCTGGGCGGCGACGACCAGGGCGGCCAGCCGGACGTCGCTCGGCCGCCCAAG
ACGGAGGAGGCGGACCCCGAAGTCGAGCGCGAGAAGAAGGCGCGCAACCTCCGGAAAAAGCTGAAGCAGGCCAGG
GACCTGCAGAGCAAGAAGGAGGGCGGCGAGACGCTGCTGCCGGAGCAGATCGCAAAGGTCATCAAGATCAACGAG
CTCATCCGCGAGCTCAACGCCCTCGGCCTCGACGACGAACAGGAGGCCAAGGCCGGCCCCGACGCATCGCGGGCG
CCCAGCGGAACCAGTGGCCGAGACTGA
Transcript >Hirsu2|5231
ATGTCTTCCTCCCCCGCCACCAACTCGGGCATCGTCACCGACGAGGGCAGCGGACAGCGCCACATCCCCGAGTCG
GTCCGGGCCGACGGCAGCACTCGCAAGGCCATCAAGATCCGCCCGGGCTACCGCCCGCCCGAGGACGTCGAGGTC
TACAAGAACCGCACCGCCGAGGCGTTCCGCGACCGCGGCAAGAAGGCGGGCATCCCCGGCGCCGCCGGCCTCCAG
CCGGAGCAGGGCGCCTCGGCGAGCAGCAGCAGCAGCAAGAACGCCAAGAGACGGGAGGCGCGTAAGAAGGCTGCC
AAGGCCGCGGCCGACGGCGACGACCTGGGCGGCGACGACCAGGGCGGCCAGCCGGACGTCGCTCGGCCGCCCAAG
ACGGAGGAGGCGGACCCCGAAGTCGAGCGCGAGAAGAAGGCGCGCAACCTCCGGAAAAAGCTGAAGCAGGCCAGG
GACCTGCAGAGCAAGAAGGAGGGCGGCGAGACGCTGCTGCCGGAGCAGATCGCAAAGGTCATCAAGATCAACGAG
CTCATCCGCGAGCTCAACGCCCTCGGCCTCGACGACGAACAGGAGGCCAAGGCCGGCCCCGACGCATCGCGGGCG
CCCAGCGGAACCAGTGGCCGAGACTGA
Gene >Hirsu2|5231
ATGTCTTCCTCCCCCGCCACCAACTCGGGCATCGTCACCGACGAGGGCAGCGGACAGCGCCACATCCCCGAGTCG
GTCCGGGCCGACGGCAGCACTCGCAAGGCCATCAAGATCCGCCCGGGCTACCGCCCGCCCGAGGACGTCGAGGTC
TACAAGAACCGCACCGCCGAGGCGTTCCGCGACCGCGGCAAGAAGGCGGGCATCCCCGGCGCCGCCGGCCTCCAG
CCGGAGCAGGGCGCCTCGGCGAGCAGCAGCAGCAGCAAGAACGCCAAGAGACGGGAGGCGCGTAAGAAGGCTGCC
AAGGCCGCGGCCGACGGCGACGACCTGGGCGGCGACGACCAGGGCGGCCAGCCGGACGTCGCTCGGCCGCCCAAG
ACGGAGGAGGCGGACCCCGAAGTCGAGCGCGAGAAGAAGGCGCGCAACCTCCGGAAAAAGCTGAAGCAGGCCAGG
GACCTGCAGAGCAAGAAGGAGGGCGGCGAGACGCTGCTGCCGGAGCAGATCGCAAAGGTCATCAAGATCAACGAG
CTCATCCGCGAGCTCAACGCCCTCGGCCTCGACGACGAACAGGAGGCCAAGGCCGGCCCCGACGCATCGCGGGCG
CCCAGCGGAACCAGTGGCCGAGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail