Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5229
Gene name
LocationContig_261:8699..9161
Strand-
Gene length (bp)462
Transcript length (bp)204
Coding sequence length (bp)204
Protein length (aa) 68

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like 1.7E-24 5 57

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P22289|QCR9_YEAST Cytochrome b-c1 complex subunit 9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QCR9 PE=1 SV=2 5 56 2.0E-10
sp|Q6CJX2|QCR9_KLULA Cytochrome b-c1 complex subunit 9 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=QCR9 PE=3 SV=3 1 54 3.0E-10
sp|O74433|QCR9_SCHPO Cytochrome b-c1 complex subunit 9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=qcr9 PE=3 SV=2 4 67 3.0E-06

GO

GO Term Description Terminal node
GO:0005750 mitochondrial respiratory chain complex III Yes
GO:0005743 mitochondrial inner membrane Yes
GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c Yes
GO:0044446 intracellular organelle part No
GO:0009987 cellular process No
GO:1990204 oxidoreductase complex No
GO:0022900 electron transport chain No
GO:0032991 protein-containing complex No
GO:0044424 intracellular part No
GO:0006091 generation of precursor metabolites and energy No
GO:0019866 organelle inner membrane No
GO:0045275 respiratory chain complex III No
GO:0044444 cytoplasmic part No
GO:0044464 cell part No
GO:0022904 respiratory electron transport chain No
GO:0016020 membrane No
GO:0044425 membrane part No
GO:0044455 mitochondrial membrane part No
GO:0098800 inner mitochondrial membrane protein complex No
GO:0044237 cellular metabolic process No
GO:1902494 catalytic complex No
GO:0070069 cytochrome complex No
GO:0098803 respiratory chain complex No
GO:0031966 mitochondrial membrane No
GO:0098798 mitochondrial protein complex No
GO:0031090 organelle membrane No
GO:0055114 oxidation-reduction process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0044429 mitochondrial part No
GO:0044422 organelle part No
GO:0098796 membrane protein complex No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5229
MSLGSQIYSTFFKKNYAMLAAVFGAGFAFEMGFNSSMNRFWDNHNRGRQWKDIRSRYVESAEEDDDE*
Coding >Hirsu2|5229
ATGTCCCTCGGCAGCCAAATCTACAGCACCTTCTTCAAGAAGAACTACGCCATGCTGGCGGCCGTCTTCGGTGCT
GGCTTCGCATTCGAGATGGGCTTCAATTCCAGCATGAACCGATTCTGGGATAACCACAACCGAGGCCGTCAATGG
AAGGATATCCGGAGCAGATACGTCGAGAGTGCCGAGGAGGACGACGACGAGTAA
Transcript >Hirsu2|5229
ATGTCCCTCGGCAGCCAAATCTACAGCACCTTCTTCAAGAAGAACTACGCCATGCTGGCGGCCGTCTTCGGTGCT
GGCTTCGCATTCGAGATGGGCTTCAATTCCAGCATGAACCGATTCTGGGATAACCACAACCGAGGCCGTCAATGG
AAGGATATCCGGAGCAGATACGTCGAGAGTGCCGAGGAGGACGACGACGAGTAA
Gene >Hirsu2|5229
ATGGTAAGCCCCATCCTCGCGGCACCCGACCGCGCCGTCACCACGCCGGCTAATCTCGCCTCCTCCAGTCCCTCG
GCAGCCAAATCTACAGGCGAGTCTCGTCGACGACACGACATGGAGCCGGATGCTTACGGGCGACCCTGCAGCACC
TTCTTCAAGAAGAACTACGCCATGCTGGCGGCCGTCTTCGGTGCTGGCTTCGCATTCGAGATGTACGGTGGGCCC
CTGCGATATCATGGGATGTCATGGACGGATGGATGGATCGGACGATGGATTGATGGCTGACATTGGCGCCACAGG
GGCTTCAATTCCAGCATGAACCGATTCTGGGATAACCACAACCGAGGCGTACGTGGTGCCCGCATGCCGCGAGAG
GACCTTGACTGACGTGAGGGCCAGCGTCAATGGAAGGATATCCGGAGCAGATACGTCGAGAGTGCCGAGGAGGAC
GACGACGAGTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail