© 2020 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Hirsu2|5229 |
| Gene name | |
| Location | Contig_261:8699..9161 |
| Strand | - |
| Gene length (bp) | 462 |
| Transcript length (bp) | 204 |
| Coding sequence length (bp) | 204 |
| Protein length (aa) | 68 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF05365 | UCR_UQCRX_QCR9 | Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like | 1.7E-24 | 5 | 57 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P22289|QCR9_YEAST | Cytochrome b-c1 complex subunit 9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QCR9 PE=1 SV=2 | 5 | 56 | 2.0E-10 |
| sp|Q6CJX2|QCR9_KLULA | Cytochrome b-c1 complex subunit 9 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=QCR9 PE=3 SV=3 | 1 | 54 | 3.0E-10 |
| sp|O74433|QCR9_SCHPO | Cytochrome b-c1 complex subunit 9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=qcr9 PE=3 SV=2 | 4 | 67 | 3.0E-06 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0005750 | mitochondrial respiratory chain complex III | Yes |
| GO:0005743 | mitochondrial inner membrane | Yes |
| GO:0006122 | mitochondrial electron transport, ubiquinol to cytochrome c | Yes |
| GO:0044446 | intracellular organelle part | No |
| GO:0009987 | cellular process | No |
| GO:1990204 | oxidoreductase complex | No |
| GO:0022900 | electron transport chain | No |
| GO:0032991 | protein-containing complex | No |
| GO:0044424 | intracellular part | No |
| GO:0006091 | generation of precursor metabolites and energy | No |
| GO:0019866 | organelle inner membrane | No |
| GO:0045275 | respiratory chain complex III | No |
| GO:0044444 | cytoplasmic part | No |
| GO:0044464 | cell part | No |
| GO:0022904 | respiratory electron transport chain | No |
| GO:0016020 | membrane | No |
| GO:0044425 | membrane part | No |
| GO:0044455 | mitochondrial membrane part | No |
| GO:0098800 | inner mitochondrial membrane protein complex | No |
| GO:0044237 | cellular metabolic process | No |
| GO:1902494 | catalytic complex | No |
| GO:0070069 | cytochrome complex | No |
| GO:0098803 | respiratory chain complex | No |
| GO:0031966 | mitochondrial membrane | No |
| GO:0098798 | mitochondrial protein complex | No |
| GO:0031090 | organelle membrane | No |
| GO:0055114 | oxidation-reduction process | No |
| GO:0008152 | metabolic process | No |
| GO:0008150 | biological_process | No |
| GO:0044429 | mitochondrial part | No |
| GO:0044422 | organelle part | No |
| GO:0098796 | membrane protein complex | No |
| GO:0005575 | cellular_component | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 29 | 0.5 |
| Domain # | Start | End | Length |
|---|---|---|---|
| 1 | 15 | 37 | 22 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Hirsu2|5229 MSLGSQIYSTFFKKNYAMLAAVFGAGFAFEMGFNSSMNRFWDNHNRGRQWKDIRSRYVESAEEDDDE* |
| Coding | >Hirsu2|5229 ATGTCCCTCGGCAGCCAAATCTACAGCACCTTCTTCAAGAAGAACTACGCCATGCTGGCGGCCGTCTTCGGTGCT GGCTTCGCATTCGAGATGGGCTTCAATTCCAGCATGAACCGATTCTGGGATAACCACAACCGAGGCCGTCAATGG AAGGATATCCGGAGCAGATACGTCGAGAGTGCCGAGGAGGACGACGACGAGTAA |
| Transcript | >Hirsu2|5229 ATGTCCCTCGGCAGCCAAATCTACAGCACCTTCTTCAAGAAGAACTACGCCATGCTGGCGGCCGTCTTCGGTGCT GGCTTCGCATTCGAGATGGGCTTCAATTCCAGCATGAACCGATTCTGGGATAACCACAACCGAGGCCGTCAATGG AAGGATATCCGGAGCAGATACGTCGAGAGTGCCGAGGAGGACGACGACGAGTAA |
| Gene | >Hirsu2|5229 ATGGTAAGCCCCATCCTCGCGGCACCCGACCGCGCCGTCACCACGCCGGCTAATCTCGCCTCCTCCAGTCCCTCG GCAGCCAAATCTACAGGCGAGTCTCGTCGACGACACGACATGGAGCCGGATGCTTACGGGCGACCCTGCAGCACC TTCTTCAAGAAGAACTACGCCATGCTGGCGGCCGTCTTCGGTGCTGGCTTCGCATTCGAGATGTACGGTGGGCCC CTGCGATATCATGGGATGTCATGGACGGATGGATGGATCGGACGATGGATTGATGGCTGACATTGGCGCCACAGG GGCTTCAATTCCAGCATGAACCGATTCTGGGATAACCACAACCGAGGCGTACGTGGTGCCCGCATGCCGCGAGAG GACCTTGACTGACGTGAGGGCCAGCGTCAATGGAAGGATATCCGGAGCAGATACGTCGAGAGTGCCGAGGAGGAC GACGACGAGTAA |