Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5226
Gene name
LocationContig_2609:58..310
Strand+
Gene length (bp)252
Transcript length (bp)252
Coding sequence length (bp)252
Protein length (aa) 84

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.5922 0.5946 0.291 0.1193 0.3957 0.0865 0.2172 0.3445 0.2342 0.0169

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup146
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4387
Ophiocordyceps australis 1348a (Ghana) OphauG2|5166
Ophiocordyceps australis map64 (Brazil) OphauB2|6091
Ophiocordyceps australis map64 (Brazil) OphauB2|6092
Ophiocordyceps australis map64 (Brazil) OphauB2|6093
Ophiocordyceps australis map64 (Brazil) OphauB2|87
Ophiocordyceps camponoti-floridani Ophcf2|02677
Ophiocordyceps camponoti-rufipedis Ophun1|4371
Ophiocordyceps kimflemingae Ophio5|2062
Ophiocordyceps kimflemingae Ophio5|4888
Ophiocordyceps kimflemingae Ophio5|8395
Ophiocordyceps subramaniannii Hirsu2|5226 (this protein)
Ophiocordyceps subramaniannii Hirsu2|9012

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5226
MNRRWAGALPAAGTGPQARQRGMVLNRGWGDSPGSSCEFLGGWEESGARRAEAGGESTTTLYGFPGLVFEVLKND
YVNTVTVF*
Coding >Hirsu2|5226
ATGAACAGGCGGTGGGCTGGCGCGCTGCCGGCGGCGGGGACGGGGCCGCAGGCGCGGCAGCGCGGCATGGTGCTC
AACCGCGGCTGGGGCGACAGCCCGGGCAGCAGCTGCGAGTTCCTCGGCGGCTGGGAGGAGAGCGGGGCGCGGCGG
GCCGAGGCGGGCGGCGAGTCGACGACGACGCTGTACGGCTTCCCGGGCCTGGTGTTTGAGGTGCTGAAGAACGAC
TACGTGAATACGGTGACGGTTTTTTGA
Transcript >Hirsu2|5226
ATGAACAGGCGGTGGGCTGGCGCGCTGCCGGCGGCGGGGACGGGGCCGCAGGCGCGGCAGCGCGGCATGGTGCTC
AACCGCGGCTGGGGCGACAGCCCGGGCAGCAGCTGCGAGTTCCTCGGCGGCTGGGAGGAGAGCGGGGCGCGGCGG
GCCGAGGCGGGCGGCGAGTCGACGACGACGCTGTACGGCTTCCCGGGCCTGGTGTTTGAGGTGCTGAAGAACGAC
TACGTGAATACGGTGACGGTTTTTTGA
Gene >Hirsu2|5226
ATGAACAGGCGGTGGGCTGGCGCGCTGCCGGCGGCGGGGACGGGGCCGCAGGCGCGGCAGCGCGGCATGGTGCTC
AACCGCGGCTGGGGCGACAGCCCGGGCAGCAGCTGCGAGTTCCTCGGCGGCTGGGAGGAGAGCGGGGCGCGGCGG
GCCGAGGCGGGCGGCGAGTCGACGACGACGCTGTACGGCTTCCCGGGCCTGGTGTTTGAGGTGCTGAAGAACGAC
TACGTGAATACGGTGACGGTTTTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail