Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5219
Gene name
LocationContig_2600:57..797
Strand+
Gene length (bp)740
Transcript length (bp)621
Coding sequence length (bp)621
Protein length (aa) 207

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 9.0E-10 6 131

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q10097|YAOI_SCHPO Uncharacterized transporter C11D3.18C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.18c PE=3 SV=1 6 204 2.0E-34
sp|Q9US44|YIZG_SCHPO Uncharacterized transporter C1002.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1002.16c PE=3 SV=1 6 205 3.0E-34
sp|P53322|TNA1_YEAST High-affinity nicotinic acid transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TNA1 PE=1 SV=1 6 205 2.0E-31
sp|Q9P6J0|YHDC_SCHPO Uncharacterized transporter C1683.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.12 PE=3 SV=1 6 193 7.0E-24
sp|Q9US37|YFZ4_SCHPO Uncharacterized transporter C1039.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.04 PE=3 SV=1 5 204 3.0E-14

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.5

Transmembrane Domains

Domain # Start End Length
1 26 48 22
2 55 74 19
3 79 101 22
4 114 136 22
5 146 168 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5219
LPKKKGFSTFLPTIINDLGRWTLPQVQLLTVPCYFVGAAAYMAAAAASDRTQRRGPFCVAFGLVSILGYALLLAD
AAPALHYFACFLVAAGLYVVVGLPLAWLPDNSPRYGKRATATGLQLTVGNVAGILSGFIYPKEDAPRYVRGHAIT
LAMVAMGTAIYGLMWLWFRRENRRREREPLAEEHRRMKEDELEELGDDSPRYRYMT*
Coding >Hirsu2|5219
CTGCCAAAAAAAAAAGGCTTCTCGACCTTCCTGCCGACCATCATCAACGACCTCGGCCGCTGGACGCTGCCGCAG
GTCCAGCTGCTGACGGTGCCGTGCTACTTCGTCGGCGCCGCCGCCTACATGGCCGCCGCCGCCGCCTCGGACCGC
ACCCAGCGCCGCGGGCCCTTCTGCGTCGCCTTCGGCCTCGTCAGCATCCTCGGCTACGCCCTGCTGCTGGCCGAC
GCCGCGCCCGCCCTGCACTACTTCGCCTGCTTCCTCGTCGCCGCCGGCCTGTACGTCGTCGTCGGCCTGCCGCTC
GCCTGGCTGCCCGACAACTCGCCGCGCTACGGCAAGCGCGCGACCGCCACGGGGCTGCAGCTGACCGTCGGCAAC
GTCGCCGGCATCCTCTCCGGCTTCATCTACCCCAAGGAAGATGCGCCGAGGTACGTGCGCGGCCACGCCATCACG
CTGGCCATGGTGGCCATGGGGACCGCCATCTATGGCCTCATGTGGCTCTGGTTCCGGCGCGAGAACCGCCGCCGC
GAGCGCGAGCCGCTGGCCGAGGAGCACCGTCGGATGAAGGAGGACGAGCTGGAGGAGCTGGGCGACGACAGCCCG
CGATACCGATACATGACTTGA
Transcript >Hirsu2|5219
CTGCCAAAAAAAAAAGGCTTCTCGACCTTCCTGCCGACCATCATCAACGACCTCGGCCGCTGGACGCTGCCGCAG
GTCCAGCTGCTGACGGTGCCGTGCTACTTCGTCGGCGCCGCCGCCTACATGGCCGCCGCCGCCGCCTCGGACCGC
ACCCAGCGCCGCGGGCCCTTCTGCGTCGCCTTCGGCCTCGTCAGCATCCTCGGCTACGCCCTGCTGCTGGCCGAC
GCCGCGCCCGCCCTGCACTACTTCGCCTGCTTCCTCGTCGCCGCCGGCCTGTACGTCGTCGTCGGCCTGCCGCTC
GCCTGGCTGCCCGACAACTCGCCGCGCTACGGCAAGCGCGCGACCGCCACGGGGCTGCAGCTGACCGTCGGCAAC
GTCGCCGGCATCCTCTCCGGCTTCATCTACCCCAAGGAAGATGCGCCGAGGTACGTGCGCGGCCACGCCATCACG
CTGGCCATGGTGGCCATGGGGACCGCCATCTATGGCCTCATGTGGCTCTGGTTCCGGCGCGAGAACCGCCGCCGC
GAGCGCGAGCCGCTGGCCGAGGAGCACCGTCGGATGAAGGAGGACGAGCTGGAGGAGCTGGGCGACGACAGCCCG
CGATACCGATACATGACTTGA
Gene >Hirsu2|5219
CTGCCAAAAAAAAAAGGCTTCTCGACCTTCCTGCCGACCATCATCAACGACCTCGGCCGCTGGACGCTGCCGCAG
GTCCAGCTGCTGACGGTGCCGTGCTACTTCGTCGGCGCCGCCGCCTACATGGCCGCCGCCGCCGCCTCGGACCGC
ACCCAGCGCCGCGGGCCCTTCTGCGTCGCCTTCGGCCTCGTCAGCATCCTCGGCTACGCCCTGCTGCTGGCCGAC
GCCGCGCCCGCCCTGCACTACTTCGCCTGCTTCCTCGTCGCCGCCGGCCTGTACGTCGTCGTCGGCCTGCCGCTC
GCCTGGCTGCCCGACAACTCGCCGCGCTACGGCAAGCGCGCGACCGCCACGGGGCTGCAGCTGACCGTCGGCAAC
GTCGCCGGCATCCTCTCCGGCTTCATCTAGTGCGTCCGCTCCCTTCTTTTCTCATCTCTCCCTTCTTCTTCCTTC
TCCTCCCCGTCTTCGTGTCGTCAGCCGTCGTCTTGGTCCTGTATGTTTCGCCGCTGACGACAAGACGGAAAAGCC
CCAAGGAAGATGCGCCGAGGTACGTGCGCGGCCACGCCATCACGCTGGCCATGGTGGCCATGGGGACCGCCATCT
ATGGCCTCATGTGGCTCTGGTTCCGGCGCGAGAACCGCCGCCGCGAGCGCGAGCCGCTGGCCGAGGAGCACCGTC
GGATGAAGGAGGACGAGCTGGAGGAGCTGGGCGACGACAGCCCGCGATACCGATACATGACTTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail