Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5215
Gene name
LocationContig_260:10439..12254
Strand+
Gene length (bp)1815
Transcript length (bp)1590
Coding sequence length (bp)1590
Protein length (aa) 530

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00710 Asparaginase Asparaginase, N-terminal 4.5E-58 19 237
PF17763 Asparaginase_C Glutaminase/Asparaginase C-terminal domain 5.0E-23 257 366
PF12796 Ank_2 Ankyrin repeats (3 copies) 1.3E-07 418 481
PF13606 Ank_3 Ankyrin repeat 3.5E-04 452 479
PF00023 Ank Ankyrin repeat 4.0E-03 452 482

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O88202|LPP60_RAT 60 kDa lysophospholipase OS=Rattus norvegicus GN=Aspg PE=1 SV=1 16 517 7.0E-91
sp|A0JNU3|LPP60_MOUSE 60 kDa lysophospholipase OS=Mus musculus GN=Aspg PE=1 SV=1 16 517 1.0E-90
sp|Q9U518|ASPG_DIRIM L-asparaginase OS=Dirofilaria immitis PE=1 SV=1 17 513 1.0E-89
sp|Q86U10|LPP60_HUMAN 60 kDa lysophospholipase OS=Homo sapiens GN=ASPG PE=2 SV=3 16 518 1.0E-83
sp|P0A962|ASPG1_ECOLI L-asparaginase 1 OS=Escherichia coli (strain K12) GN=ansA PE=1 SV=1 15 388 2.0E-70
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O88202|LPP60_RAT 60 kDa lysophospholipase OS=Rattus norvegicus GN=Aspg PE=1 SV=1 16 517 7.0E-91
sp|A0JNU3|LPP60_MOUSE 60 kDa lysophospholipase OS=Mus musculus GN=Aspg PE=1 SV=1 16 517 1.0E-90
sp|Q9U518|ASPG_DIRIM L-asparaginase OS=Dirofilaria immitis PE=1 SV=1 17 513 1.0E-89
sp|Q86U10|LPP60_HUMAN 60 kDa lysophospholipase OS=Homo sapiens GN=ASPG PE=2 SV=3 16 518 1.0E-83
sp|P0A962|ASPG1_ECOLI L-asparaginase 1 OS=Escherichia coli (strain K12) GN=ansA PE=1 SV=1 15 388 2.0E-70
sp|P0A963|ASPG1_ECO57 L-asparaginase 1 OS=Escherichia coli O157:H7 GN=ansA PE=3 SV=1 15 388 2.0E-70
sp|P26900|ASPG1_BACSU L-asparaginase 1 OS=Bacillus subtilis (strain 168) GN=ansA PE=2 SV=1 18 366 2.0E-42
sp|Q9Y9T8|GATD_AERPE Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=gatD PE=3 SV=1 17 389 8.0E-31
sp|A5UK11|GATD_METS3 Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=gatD PE=3 SV=1 111 395 7.0E-29
sp|A1RX40|GATD_THEPD Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Thermofilum pendens (strain Hrk 5) GN=gatD PE=3 SV=1 2 397 6.0E-28
sp|Q9V0T9|GATD_PYRAB Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=gatD PE=1 SV=1 103 363 3.0E-27
sp|O59132|GATD_PYRHO Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=gatD PE=3 SV=1 103 366 2.0E-26
sp|A6VGK5|GATD_METM7 Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=gatD PE=3 SV=1 103 386 2.0E-26
sp|Q971W5|GATD_SULTO Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=gatD PE=3 SV=1 103 369 1.0E-25
sp|Q60331|GATD_METJA Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=gatD PE=3 SV=1 126 392 1.0E-25
sp|Q8U0X0|GATD_PYRFU Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=gatD PE=3 SV=1 103 394 2.0E-25
sp|Q5JI77|GATD_THEKO Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=gatD PE=3 SV=1 126 366 1.0E-24
sp|Q8TV84|GATD_METKA Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=gatD PE=3 SV=1 103 367 2.0E-24
sp|A9AA46|GATD_METM6 Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=gatD PE=3 SV=1 103 363 4.0E-24
sp|O29380|GATD_ARCFU Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=gatD PE=3 SV=1 96 363 4.0E-24
sp|Q2NEH1|GATD_METST Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=gatD PE=3 SV=1 111 387 1.0E-23
sp|P61400|GATD_METMP Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Methanococcus maripaludis (strain S2 / LL) GN=gatD PE=3 SV=1 103 389 5.0E-23
sp|Q97ZH5|GATD_SULSO Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=gatD PE=3 SV=1 111 366 1.0E-22
sp|A4YHH3|GATD_METS5 Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=gatD PE=3 SV=1 96 366 4.0E-22
sp|A6UPR4|GATD_METVS Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=gatD PE=3 SV=1 103 363 6.0E-22
sp|Q4J955|GATD_SULAC Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=gatD PE=3 SV=1 96 369 6.0E-22
sp|C3MPS1|GATD_SULIL Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=gatD PE=3 SV=1 111 369 1.0E-21
sp|A4FWR5|GATD_METM5 Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=gatD PE=3 SV=1 103 389 1.0E-21
sp|Q9HJJ5|GATD_THEAC Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=gatD PE=3 SV=1 99 394 2.0E-21
sp|C3N5E7|GATD_SULIA Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Sulfolobus islandicus (strain M.16.27) GN=gatD PE=3 SV=1 111 369 2.0E-21
sp|C3NE01|GATD_SULIY Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=gatD PE=3 SV=1 111 369 2.0E-21
sp|C3NHQ2|GATD_SULIN Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=gatD PE=3 SV=1 111 369 2.0E-21
sp|C3MYR5|GATD_SULIM Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=gatD PE=3 SV=1 111 369 2.0E-21
sp|C4KH13|GATD_SULIK Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=gatD PE=3 SV=1 111 369 2.0E-21
sp|O26802|GATD_METTH Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=gatD PE=1 SV=1 116 366 4.0E-21
sp|Q8ZY04|GATD_PYRAE Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=gatD PE=3 SV=1 103 363 7.0E-21
sp|Q12X65|GATD_METBU Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=gatD PE=3 SV=1 103 369 2.0E-19
sp|Q46GJ6|GATD_METBF Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=gatD PE=3 SV=1 103 363 1.0E-18
sp|Q8TR66|GATD_METAC Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=gatD PE=3 SV=1 103 392 4.0E-18
sp|Q9HP20|GATD_HALSA Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=gatD PE=3 SV=1 111 396 3.0E-17
sp|B0R6H4|GATD_HALS3 Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=gatD PE=3 SV=1 111 396 3.0E-17
sp|Q8PUM7|GATD_METMA Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=gatD PE=3 SV=1 3 389 7.0E-17
sp|Q979L8|GATD_THEVO Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=gatD PE=3 SV=1 103 387 8.0E-17
sp|Q18GL3|GATD_HALWD Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=gatD PE=3 SV=1 112 393 1.0E-15
sp|P61401|GATD_NANEQ Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Nanoarchaeum equitans (strain Kin4-M) GN=gatD PE=3 SV=1 103 368 6.0E-15
sp|P30363|ASPG_BACLI L-asparaginase OS=Bacillus licheniformis GN=ansA PE=3 SV=1 125 366 9.0E-11
sp|P43843|ASPG2_HAEIN Probable L-asparaginase periplasmic OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ansB PE=1 SV=1 111 294 6.0E-08
sp|P50286|ASPG_WOLSU L-asparaginase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=ansA PE=1 SV=2 96 325 8.0E-08
sp|Q7XUW4|KOR2_ORYSJ Potassium channel KOR2 OS=Oryza sativa subsp. japonica GN=Os04g0445000 PE=2 SV=2 446 515 2.0E-07
sp|P00805|ASPG2_ECOLI L-asparaginase 2 OS=Escherichia coli (strain K12) GN=ansB PE=1 SV=2 111 251 4.0E-07
sp|Q8T2Q0|ZDHC6_DICDI Putative ZDHHC-type palmitoyltransferase 6 OS=Dictyostelium discoideum GN=DDB_G0275149 PE=2 SV=1 418 497 8.0E-07
sp|Q9ZLB9|ASPG_HELPJ Probable L-asparaginase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=ansA PE=1 SV=1 58 325 1.0E-06
sp|Q7Z020|TRPA1_DROME Transient receptor potential cation channel subfamily A member 1 OS=Drosophila melanogaster GN=TrpA1 PE=2 SV=4 421 511 3.0E-06
sp|O25424|ASPG_HELPY Probable L-asparaginase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=ansA PE=3 SV=1 58 325 5.0E-06
sp|Q3ZBX7|ANKR1_BOVIN Ankyrin repeat domain-containing protein 1 OS=Bos taurus GN=ANKRD1 PE=2 SV=1 415 517 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5215
MSPSQVDETTADAGLPESRVLIIGTGGTICMQNGPDGLAPSANFLMDAMAPRSTFNDGSTVSVQLQAFFQGESRS
LESLRTPPTAHQRHIRYGMLEFLPLLDSSSICASDWAAMAETVRENYALFDGFVILHGTDSLAYTASALSFLFAN
LGKPVILTGSQAPIFALQSDAVDNLLGSLIIAGTYAIPEVGLFFHHKLYRGNRTTKVSSAAFEAFASPNCDPLAR
VNGLGIEVNWPLVLRPTRIAEFRVGRPLDTTHVACLRVFPGIKPEMVDAVLHLPDIRGLILETFGMGNVPGGAGG
ALTRVIRAAVERGVIVVNVSQCVSGFAYPVYAAGFHLDRAGVLFGLDLTAEAALAKLSYLLANRPDDDRHPAGDI
AADFSRSLRGELTEMARPTFAHPAAPLVDPAAAGLVTPLESAFTALGYAIQKREVAVVRRLLDGEGAQLLTTADY
AGNTALHLAAVSGSTDVMLELLRRGAGVHARNRANNSPLFLATLSGDDACARLLKSAGAHLSVEEIERGPLAKYR
RDMA*
Coding >Hirsu2|5215
ATGTCGCCCTCGCAGGTCGACGAGACGACCGCCGATGCCGGCCTGCCCGAGTCCAGGGTGCTGATCATCGGCACC
GGAGGCACCATCTGCATGCAGAACGGGCCCGACGGCCTGGCCCCGAGCGCCAACTTTCTGATGGACGCCATGGCG
CCCCGGTCGACGTTTAACGACGGGTCTACCGTCAGCGTCCAGCTGCAGGCCTTCTTCCAGGGCGAGAGCCGCAGC
CTGGAGTCGCTGCGGACGCCGCCGACGGCGCACCAGCGGCACATACGGTACGGCATGCTCGAGTTCCTGCCGCTG
CTCGACTCGTCCTCGATCTGCGCCTCGGACTGGGCGGCGATGGCGGAGACGGTTCGGGAGAACTACGCCCTCTTC
GACGGCTTCGTCATCCTGCACGGCACCGACTCGCTCGCCTACACCGCCTCGGCCCTGTCCTTCCTCTTCGCCAAC
CTGGGCAAGCCGGTGATCCTGACGGGCTCGCAGGCGCCCATCTTCGCGCTGCAGTCGGACGCCGTCGACAACCTG
CTCGGGTCGCTCATCATCGCCGGCACCTACGCCATCCCCGAGGTCGGCCTCTTTTTCCACCACAAGCTGTACCGC
GGCAACCGCACGACCAAGGTCTCGTCGGCCGCCTTCGAGGCCTTCGCCAGCCCCAACTGCGACCCGCTCGCGCGC
GTCAACGGGCTCGGCATCGAGGTCAACTGGCCGCTCGTGCTGCGGCCGACGCGCATCGCCGAGTTCCGCGTCGGC
CGCCCGCTCGACACGACGCACGTCGCCTGCCTGCGCGTCTTCCCCGGCATCAAGCCCGAGATGGTCGACGCCGTC
CTGCACCTGCCCGACATCCGCGGCCTCATCCTCGAGACCTTCGGCATGGGCAACGTCCCCGGCGGCGCCGGCGGC
GCCCTGACCCGCGTCATTCGCGCCGCCGTCGAGCGCGGCGTCATCGTCGTCAACGTCAGCCAGTGCGTCAGCGGC
TTCGCTTACCCCGTCTACGCCGCCGGCTTCCACCTCGACCGCGCCGGCGTCCTCTTCGGCCTCGACCTGACCGCC
GAGGCCGCCCTGGCCAAGCTGTCCTACCTGCTTGCCAACCGCCCGGACGACGACCGCCACCCCGCCGGCGACATC
GCCGCTGACTTCTCCCGCTCCCTGCGCGGCGAGCTGACCGAGATGGCCCGTCCGACCTTCGCCCACCCGGCCGCC
CCGCTCGTCGACCCGGCCGCCGCCGGCCTCGTCACTCCGCTCGAGTCGGCCTTCACCGCCCTCGGCTACGCCATC
CAGAAGCGCGAGGTGGCCGTTGTCCGCCGCCTGCTCGACGGCGAGGGCGCCCAGCTGCTGACGACGGCCGACTAC
GCCGGCAACACGGCCCTGCACCTGGCCGCCGTCTCTGGCAGCACCGACGTCATGCTCGAGCTGCTCCGCCGCGGC
GCCGGCGTCCACGCCCGCAACCGCGCCAACAACTCGCCCCTCTTCCTCGCCACCCTCTCCGGCGATGACGCCTGC
GCCCGCCTCCTCAAGTCCGCCGGCGCCCACCTGTCCGTCGAGGAGATCGAGCGCGGACCCCTGGCCAAGTACCGC
CGCGACATGGCCTGA
Transcript >Hirsu2|5215
ATGTCGCCCTCGCAGGTCGACGAGACGACCGCCGATGCCGGCCTGCCCGAGTCCAGGGTGCTGATCATCGGCACC
GGAGGCACCATCTGCATGCAGAACGGGCCCGACGGCCTGGCCCCGAGCGCCAACTTTCTGATGGACGCCATGGCG
CCCCGGTCGACGTTTAACGACGGGTCTACCGTCAGCGTCCAGCTGCAGGCCTTCTTCCAGGGCGAGAGCCGCAGC
CTGGAGTCGCTGCGGACGCCGCCGACGGCGCACCAGCGGCACATACGGTACGGCATGCTCGAGTTCCTGCCGCTG
CTCGACTCGTCCTCGATCTGCGCCTCGGACTGGGCGGCGATGGCGGAGACGGTTCGGGAGAACTACGCCCTCTTC
GACGGCTTCGTCATCCTGCACGGCACCGACTCGCTCGCCTACACCGCCTCGGCCCTGTCCTTCCTCTTCGCCAAC
CTGGGCAAGCCGGTGATCCTGACGGGCTCGCAGGCGCCCATCTTCGCGCTGCAGTCGGACGCCGTCGACAACCTG
CTCGGGTCGCTCATCATCGCCGGCACCTACGCCATCCCCGAGGTCGGCCTCTTTTTCCACCACAAGCTGTACCGC
GGCAACCGCACGACCAAGGTCTCGTCGGCCGCCTTCGAGGCCTTCGCCAGCCCCAACTGCGACCCGCTCGCGCGC
GTCAACGGGCTCGGCATCGAGGTCAACTGGCCGCTCGTGCTGCGGCCGACGCGCATCGCCGAGTTCCGCGTCGGC
CGCCCGCTCGACACGACGCACGTCGCCTGCCTGCGCGTCTTCCCCGGCATCAAGCCCGAGATGGTCGACGCCGTC
CTGCACCTGCCCGACATCCGCGGCCTCATCCTCGAGACCTTCGGCATGGGCAACGTCCCCGGCGGCGCCGGCGGC
GCCCTGACCCGCGTCATTCGCGCCGCCGTCGAGCGCGGCGTCATCGTCGTCAACGTCAGCCAGTGCGTCAGCGGC
TTCGCTTACCCCGTCTACGCCGCCGGCTTCCACCTCGACCGCGCCGGCGTCCTCTTCGGCCTCGACCTGACCGCC
GAGGCCGCCCTGGCCAAGCTGTCCTACCTGCTTGCCAACCGCCCGGACGACGACCGCCACCCCGCCGGCGACATC
GCCGCTGACTTCTCCCGCTCCCTGCGCGGCGAGCTGACCGAGATGGCCCGTCCGACCTTCGCCCACCCGGCCGCC
CCGCTCGTCGACCCGGCCGCCGCCGGCCTCGTCACTCCGCTCGAGTCGGCCTTCACCGCCCTCGGCTACGCCATC
CAGAAGCGCGAGGTGGCCGTTGTCCGCCGCCTGCTCGACGGCGAGGGCGCCCAGCTGCTGACGACGGCCGACTAC
GCCGGCAACACGGCCCTGCACCTGGCCGCCGTCTCTGGCAGCACCGACGTCATGCTCGAGCTGCTCCGCCGCGGC
GCCGGCGTCCACGCCCGCAACCGCGCCAACAACTCGCCCCTCTTCCTCGCCACCCTCTCCGGCGATGACGCCTGC
GCCCGCCTCCTCAAGTCCGCCGGCGCCCACCTGTCCGTCGAGGAGATCGAGCGCGGACCCCTGGCCAAGTACCGC
CGCGACATGGCCTGA
Gene >Hirsu2|5215
ATGTCGCCCTCGCAGGTCGACGAGACGACCGCCGATGCCGGCCTGCCCGAGTCCAGGGTGCTGATCATCGGCACC
GGAGGCACCATCTGCATGCAGAACGGGCCCGACGGCCTGGCCCCGAGCGCCAACTTTCTGATGGACGCCATGGCG
CCCCGGTCGACGTTTAACGACGGGTCTACCGTCAGCGGTATGTCCTTCATCTTCCACCGTTTCCCCTCCCGGGGC
GAGCGGAGAGTGCGGGATGGAGGAGAGGGACTTGAAAGGAGCAGCAAGAAGAGCTGGCTGCGTTGGCGATAGCCT
CACTCTCGCTTTCTCGCCCTTTCCTTACCCTCAAGAGTGAATGGACAAGGTGAAGGAGGAAAAGGAGAAGGAAGA
GTTTCTCATGCTGACGTGCGCACGCGCCCGGACACAGTCCAGCTGCAGGCCTTCTTCCAGGGCGAGAGCCGCAGC
CTGGAGTCGCTGCGGACGCCGCCGACGGCGCACCAGCGGCACATACGGTACGGCATGCTCGAGTTCCTGCCGCTG
CTCGACTCGTCCTCGATCTGCGCCTCGGACTGGGCGGCGATGGCGGAGACGGTTCGGGAGAACTACGCCCTCTTC
GACGGCTTCGTCATCCTGCACGGCACCGACTCGCTCGCCTACACCGCCTCGGCCCTGTCCTTCCTCTTCGCCAAC
CTGGGCAAGCCGGTGATCCTGACGGGCTCGCAGGCGCCCATCTTCGCGCTGCAGTCGGACGCCGTCGACAACCTG
CTCGGGTCGCTCATCATCGCCGGCACCTACGCCATCCCCGAGGTCGGCCTCTTTTTCCACCACAAGCTGTACCGC
GGCAACCGCACGACCAAGGTCTCGTCGGCCGCCTTCGAGGCCTTCGCCAGCCCCAACTGCGACCCGCTCGCGCGC
GTCAACGGGCTCGGCATCGAGGTCAACTGGCCGCTCGTGCTGCGGCCGACGCGCATCGCCGAGTTCCGCGTCGGC
CGCCCGCTCGACACGACGCACGTCGCCTGCCTGCGCGTCTTCCCCGGCATCAAGCCCGAGATGGTCGACGCCGTC
CTGCACCTGCCCGACATCCGCGGCCTCATCCTCGAGACCTTCGGCATGGGCAACGTCCCCGGCGGCGCCGGCGGC
GCCCTGACCCGCGTCATTCGCGCCGCCGTCGAGCGCGGCGTCATCGTCGTCAACGTCAGCCAGTGCGTCAGCGGC
TTCGCTTACCCCGTCTACGCCGCCGGCTTCCACCTCGACCGCGCCGGCGTCCTCTTCGGCCTCGACCTGACCGCC
GAGGCCGCCCTGGCCAAGCTGTCCTACCTGCTTGCCAACCGCCCGGACGACGACCGCCACCCCGCCGGCGACATC
GCCGCTGACTTCTCCCGCTCCCTGCGCGGCGAGCTGACCGAGATGGCCCGTCCGACCTTCGCCCACCCGGCCGCC
CCGCTCGTCGACCCGGCCGCCGCCGGCCTCGTCACTCCGCTCGAGTCGGCCTTCACCGCCCTCGGCTACGCCATC
CAGAAGCGCGAGGTGGCCGTTGTCCGCCGCCTGCTCGACGGCGAGGGCGCCCAGCTGCTGACGACGGCCGACTAC
GCCGGCAACACGGCCCTGCACCTGGCCGCCGTCTCTGGCAGCACCGACGTCATGCTCGAGCTGCTCCGCCGCGGC
GCCGGCGTCCACGCCCGCAACCGCGCCAACAACTCGCCCCTCTTCCTCGCCACCCTCTCCGGCGATGACGCCTGC
GCCCGCCTCCTCAAGTCCGCCGGCGCCCACCTGTCCGTCGAGGAGATCGAGCGCGGACCCCTGGCCAAGTACCGC
CGCGACATGGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail