Protein ID | Hirsu2|5211 |
Gene name | |
Location | Contig_260:21..816 |
Strand | + |
Gene length (bp) | 795 |
Transcript length (bp) | 795 |
Coding sequence length (bp) | 795 |
Protein length (aa) | 265 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF00814 | TsaD | tRNA N6-adenosine threonylcarbamoyltransferase | 1.2E-59 | 2 | 229 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q4I5V2|KAE1_GIBZE | tRNA N6-adenosine threonylcarbamoyltransferase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=KAE1 PE=3 SV=2 | 1 | 263 | 4.0E-143 |
sp|Q7S745|KAE1_NEUCR | tRNA N6-adenosine threonylcarbamoyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gpe-1 PE=3 SV=1 | 1 | 263 | 5.0E-139 |
sp|Q2GXN6|KAE1_CHAGB | tRNA N6-adenosine threonylcarbamoyltransferase OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=KAE1 PE=3 SV=1 | 1 | 264 | 1.0E-135 |
sp|Q0CH39|KAE1_ASPTN | tRNA N6-adenosine threonylcarbamoyltransferase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=kae1 PE=3 SV=1 | 1 | 263 | 5.0E-135 |
sp|Q4WDE9|KAE1_ASPFU | tRNA N6-adenosine threonylcarbamoyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=kae1 PE=3 SV=1 | 1 | 263 | 5.0E-134 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q4I5V2|KAE1_GIBZE | tRNA N6-adenosine threonylcarbamoyltransferase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=KAE1 PE=3 SV=2 | 1 | 263 | 4.0E-143 |
sp|Q7S745|KAE1_NEUCR | tRNA N6-adenosine threonylcarbamoyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gpe-1 PE=3 SV=1 | 1 | 263 | 5.0E-139 |
sp|Q2GXN6|KAE1_CHAGB | tRNA N6-adenosine threonylcarbamoyltransferase OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=KAE1 PE=3 SV=1 | 1 | 264 | 1.0E-135 |
sp|Q0CH39|KAE1_ASPTN | tRNA N6-adenosine threonylcarbamoyltransferase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=kae1 PE=3 SV=1 | 1 | 263 | 5.0E-135 |
sp|Q4WDE9|KAE1_ASPFU | tRNA N6-adenosine threonylcarbamoyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=kae1 PE=3 SV=1 | 1 | 263 | 5.0E-134 |
sp|Q2U9B5|KAE1_ASPOR | tRNA N6-adenosine threonylcarbamoyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=kae1 PE=3 SV=1 | 1 | 263 | 1.0E-133 |
sp|A1CM94|KAE1_ASPCL | tRNA N6-adenosine threonylcarbamoyltransferase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=kae1 PE=3 SV=2 | 1 | 263 | 7.0E-132 |
sp|Q5AYR1|KAE1_EMENI | tRNA N6-adenosine threonylcarbamoyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=kae1 PE=3 SV=1 | 1 | 263 | 5.0E-127 |
sp|Q0TVK3|KAE1_PHANO | tRNA N6-adenosine threonylcarbamoyltransferase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=KAE1 PE=3 SV=1 | 1 | 263 | 7.0E-124 |
sp|Q6CCZ5|KAE1_YARLI | tRNA N6-adenosine threonylcarbamoyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=KAE1 PE=3 SV=1 | 1 | 263 | 3.0E-122 |
sp|Q1E406|KAE1_COCIM | tRNA N6-adenosine threonylcarbamoyltransferase OS=Coccidioides immitis (strain RS) GN=KAE1 PE=3 SV=1 | 1 | 263 | 4.0E-122 |
sp|Q9NPF4|OSGEP_HUMAN | Probable tRNA N6-adenosine threonylcarbamoyltransferase OS=Homo sapiens GN=OSGEP PE=1 SV=1 | 1 | 263 | 4.0E-121 |
sp|Q9VV41|OSGEP_DROME | Probable tRNA N6-adenosine threonylcarbamoyltransferase OS=Drosophila melanogaster GN=CG4933 PE=2 SV=1 | 1 | 263 | 7.0E-120 |
sp|Q5A6A4|KAE1_CANAL | tRNA N6-adenosine threonylcarbamoyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=KAE1 PE=3 SV=1 | 1 | 263 | 1.0E-119 |
sp|Q0VCI1|OSGEP_BOVIN | Probable tRNA N6-adenosine threonylcarbamoyltransferase OS=Bos taurus GN=OSGEP PE=2 SV=1 | 1 | 263 | 1.0E-119 |
sp|Q9WVS2|OSGEP_RAT | Probable tRNA N6-adenosine threonylcarbamoyltransferase OS=Rattus norvegicus GN=Osgep PE=2 SV=2 | 1 | 263 | 2.0E-119 |
sp|Q8BWU5|OSGEP_MOUSE | Probable tRNA N6-adenosine threonylcarbamoyltransferase OS=Mus musculus GN=Osgep PE=1 SV=2 | 1 | 263 | 2.0E-119 |
sp|O94637|KAE1_SCHPO | tRNA N6-adenosine threonylcarbamoyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgp2 PE=3 SV=1 | 1 | 263 | 3.0E-118 |
sp|Q6CJ48|KAE1_KLULA | tRNA N6-adenosine threonylcarbamoyltransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KAE1 PE=3 SV=1 | 1 | 264 | 7.0E-118 |
sp|Q7SYR1|OSGEP_XENLA | Probable tRNA N6-adenosine threonylcarbamoyltransferase OS=Xenopus laevis GN=osgep PE=2 SV=1 | 1 | 263 | 4.0E-117 |
sp|P36132|KAE1_YEAST | tRNA N6-adenosine threonylcarbamoyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KAE1 PE=1 SV=2 | 1 | 263 | 5.0E-117 |
sp|Q758R9|KAE1_ASHGO | tRNA N6-adenosine threonylcarbamoyltransferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=KAE1 PE=3 SV=1 | 1 | 263 | 2.0E-116 |
sp|Q6BNC5|KAE1_DEBHA | tRNA N6-adenosine threonylcarbamoyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=KAE1 PE=3 SV=1 | 1 | 263 | 5.0E-116 |
sp|Q6FLI1|KAE1_CANGA | tRNA N6-adenosine threonylcarbamoyltransferase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=KAE1 PE=3 SV=1 | 1 | 263 | 2.0E-115 |
sp|A7SXZ6|OSGEP_NEMVE | Probable tRNA N6-adenosine threonylcarbamoyltransferase OS=Nematostella vectensis GN=osgep PE=3 SV=1 | 18 | 263 | 8.0E-113 |
sp|P0CQ14|KAE1_CRYNJ | tRNA N6-adenosine threonylcarbamoyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=KAE1 PE=3 SV=1 | 1 | 263 | 2.0E-109 |
sp|P0CQ15|KAE1_CRYNB | tRNA N6-adenosine threonylcarbamoyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=KAE1 PE=3 SV=1 | 1 | 263 | 2.0E-109 |
sp|Q8SQQ3|KAE1_ENCCU | tRNA N6-adenosine threonylcarbamoyltransferase OS=Encephalitozoon cuniculi (strain GB-M1) GN=KAE1 PE=3 SV=1 | 1 | 263 | 5.0E-99 |
sp|Q55GU1|OSGEP_DICDI | Probable tRNA N6-adenosine threonylcarbamoyltransferase OS=Dictyostelium discoideum GN=osgep PE=3 SV=1 | 1 | 263 | 9.0E-98 |
sp|A0B5S0|KAE1_METTP | tRNA N6-adenosine threonylcarbamoyltransferase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=kae1 PE=3 SV=1 | 1 | 262 | 7.0E-78 |
sp|Q6L243|KAE1B_PICTO | Probable bifunctional tRNA threonylcarbamoyladenosine biosynthesis protein OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=PTO0374 PE=3 SV=1 | 1 | 262 | 8.0E-78 |
sp|Q12WQ7|KAE1_METBU | tRNA N6-adenosine threonylcarbamoyltransferase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=kae1 PE=3 SV=1 | 1 | 262 | 3.0E-76 |
sp|Q8PZ92|KAE1B_METMA | Probable bifunctional tRNA threonylcarbamoyladenosine biosynthesis protein OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0602 PE=3 SV=2 | 1 | 262 | 1.0E-75 |
sp|Q8TJS2|KAE1B_METAC | Probable bifunctional tRNA threonylcarbamoyladenosine biosynthesis protein OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_3705 PE=3 SV=1 | 1 | 262 | 3.0E-74 |
sp|Q58530|KAE1B_METJA | Probable bifunctional tRNA threonylcarbamoyladenosine biosynthesis protein OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1130 PE=1 SV=2 | 1 | 262 | 1.0E-73 |
sp|Q9HLA5|KAE1B_THEAC | Probable bifunctional tRNA threonylcarbamoyladenosine biosynthesis protein OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=Ta0324 PE=1 SV=1 | 5 | 262 | 2.0E-73 |
sp|Q46FS9|KAE1B_METBF | Probable bifunctional tRNA threonylcarbamoyladenosine biosynthesis protein OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=Mbar_A0279 PE=3 SV=1 | 1 | 262 | 2.0E-73 |
sp|O27476|KAE1B_METTH | Probable bifunctional tRNA threonylcarbamoyladenosine biosynthesis protein OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_1425 PE=3 SV=1 | 1 | 264 | 3.0E-73 |
sp|Q0W2P3|KAE1_METAR | tRNA N6-adenosine threonylcarbamoyltransferase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=kae1 PE=3 SV=1 | 1 | 262 | 7.0E-73 |
sp|Q5JEW3|KAE1_THEKO | tRNA N6-adenosine threonylcarbamoyltransferase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=kae1 PE=3 SV=1 | 1 | 262 | 3.0E-72 |
sp|O29153|KAE1_ARCFU | tRNA N6-adenosine threonylcarbamoyltransferase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=kae1 PE=3 SV=1 | 1 | 262 | 6.0E-72 |
sp|Q978W6|KAE1B_THEVO | Probable bifunctional tRNA threonylcarbamoyladenosine biosynthesis protein OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=TV1299 PE=3 SV=1 | 1 | 262 | 1.0E-71 |
sp|A5UMH5|KAE1B_METS3 | Probable bifunctional tRNA threonylcarbamoyladenosine biosynthesis protein OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=Msm_1198 PE=3 SV=1 | 1 | 262 | 1.0E-71 |
sp|A6US28|KAE1B_METVS | Probable bifunctional tRNA threonylcarbamoyladenosine biosynthesis protein OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=Mevan_1404 PE=3 SV=1 | 1 | 262 | 2.0E-71 |
sp|Q6M056|KAE1B_METMP | Probable bifunctional tRNA threonylcarbamoyladenosine biosynthesis protein OS=Methanococcus maripaludis (strain S2 / LL) GN=MMP0415 PE=3 SV=1 | 1 | 262 | 4.0E-71 |
sp|Q8U4B6|KAE1_PYRFU | tRNA N6-adenosine threonylcarbamoyltransferase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=kae1 PE=3 SV=1 | 1 | 262 | 3.0E-70 |
sp|C5A3G1|KAE1_THEGJ | tRNA N6-adenosine threonylcarbamoyltransferase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=kae1 PE=3 SV=1 | 1 | 262 | 2.0E-69 |
sp|A3CXS0|KAE1B_METMJ | Probable bifunctional tRNA threonylcarbamoyladenosine biosynthesis protein OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=Memar_2247 PE=3 SV=1 | 1 | 263 | 3.0E-69 |
sp|O57716|KAE1_PYRHO | tRNA N6-adenosine threonylcarbamoyltransferase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=kae1 PE=3 SV=1 | 1 | 262 | 3.0E-69 |
sp|A6VJ51|KAE1B_METM7 | Probable bifunctional tRNA threonylcarbamoyladenosine biosynthesis protein OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=MmarC7_1414 PE=3 SV=1 | 1 | 262 | 5.0E-69 |
sp|A4FZ86|KAE1B_METM5 | Probable bifunctional tRNA threonylcarbamoyladenosine biosynthesis protein OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=MmarC5_1222 PE=3 SV=1 | 1 | 262 | 1.0E-68 |
sp|A9A6L6|KAE1B_METM6 | Probable bifunctional tRNA threonylcarbamoyladenosine biosynthesis protein OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=MmarC6_0494 PE=3 SV=1 | 1 | 262 | 2.0E-68 |
sp|B6YUD9|KAE1_THEON | tRNA N6-adenosine threonylcarbamoyltransferase OS=Thermococcus onnurineus (strain NA1) GN=kae1 PE=3 SV=1 | 1 | 262 | 6.0E-68 |
sp|A2SR70|KAE1B_METLZ | Probable bifunctional tRNA threonylcarbamoyladenosine biosynthesis protein OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=Mlab_0653 PE=3 SV=1 | 1 | 264 | 5.0E-67 |
sp|Q9UXT7|KAE1_PYRAB | tRNA N6-adenosine threonylcarbamoyltransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=kae1 PE=1 SV=1 | 1 | 262 | 5.0E-67 |
sp|Q2FS43|KAE1B_METHJ | Probable bifunctional tRNA threonylcarbamoyladenosine biosynthesis protein OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=Mhun_2868 PE=3 SV=1 | 1 | 264 | 6.0E-67 |
sp|C6A5J5|KAE1_THESM | tRNA N6-adenosine threonylcarbamoyltransferase OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=kae1 PE=3 SV=1 | 19 | 262 | 3.0E-65 |
sp|Q2NIA4|KAE1B_METST | Probable bifunctional tRNA threonylcarbamoyladenosine biosynthesis protein OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=Msp_0013 PE=3 SV=1 | 1 | 264 | 1.0E-62 |
sp|A1RXD1|KAE1_THEPD | tRNA N6-adenosine threonylcarbamoyltransferase OS=Thermofilum pendens (strain Hrk 5) GN=kae1 PE=3 SV=1 | 1 | 263 | 2.0E-61 |
sp|A8MCC8|KAE1_CALMQ | tRNA N6-adenosine threonylcarbamoyltransferase OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=kae1 PE=3 SV=1 | 1 | 262 | 4.0E-59 |
sp|Q8TVD4|KAE1_METKA | tRNA N6-adenosine threonylcarbamoyltransferase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=kae1 PE=3 SV=1 | 1 | 262 | 1.0E-57 |
sp|A4YIW0|KAE1_METS5 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=kae1 PE=3 SV=1 | 1 | 263 | 2.0E-57 |
sp|P36174|KAE1B_HALMA | Probable bifunctional tRNA threonylcarbamoyladenosine biosynthesis protein OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rrnAC2490 PE=3 SV=2 | 1 | 263 | 2.0E-56 |
sp|Q9HNL6|KAE1B_HALSA | Probable bifunctional tRNA threonylcarbamoyladenosine biosynthesis protein OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=VNG_2045G PE=3 SV=2 | 1 | 263 | 2.0E-56 |
sp|Q3IMN2|KAE1B_NATPD | Probable bifunctional tRNA threonylcarbamoyladenosine biosynthesis protein OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=NP_5070A PE=3 SV=1 | 1 | 263 | 3.0E-56 |
sp|A2BJY9|KAE1_HYPBU | tRNA N6-adenosine threonylcarbamoyltransferase OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=kae1 PE=3 SV=1 | 1 | 263 | 7.0E-56 |
sp|Q4JAG1|KAE1_SULAC | tRNA N6-adenosine threonylcarbamoyltransferase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=kae1 PE=3 SV=1 | 1 | 263 | 9.0E-56 |
sp|Q18KI0|KAE1B_HALWD | Probable bifunctional tRNA threonylcarbamoyladenosine biosynthesis protein OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=HQ_1341A PE=3 SV=1 | 1 | 263 | 2.0E-54 |
sp|Q975Q7|KAE1_SULTO | tRNA N6-adenosine threonylcarbamoyltransferase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=kae1 PE=3 SV=1 | 1 | 263 | 3.0E-54 |
sp|C3NGI3|KAE1_SULIN | tRNA N6-adenosine threonylcarbamoyltransferase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=kae1 PE=3 SV=1 | 1 | 263 | 5.0E-54 |
sp|Q97ZY8|KAE1_SULSO | tRNA N6-adenosine threonylcarbamoyltransferase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=kae1 PE=3 SV=2 | 1 | 263 | 7.0E-54 |
sp|C3MWX2|KAE1_SULIM | tRNA N6-adenosine threonylcarbamoyltransferase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=kae1 PE=3 SV=1 | 1 | 263 | 8.0E-54 |
sp|C4KIB0|KAE1_SULIK | tRNA N6-adenosine threonylcarbamoyltransferase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=kae1 PE=3 SV=1 | 1 | 263 | 8.0E-54 |
sp|C3N6N9|KAE1_SULIA | tRNA N6-adenosine threonylcarbamoyltransferase OS=Sulfolobus islandicus (strain M.16.27) GN=kae1 PE=3 SV=1 | 1 | 263 | 8.0E-54 |
sp|C3N752|KAE1_SULIY | tRNA N6-adenosine threonylcarbamoyltransferase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=kae1 PE=3 SV=1 | 1 | 263 | 8.0E-54 |
sp|C3MQY4|KAE1_SULIL | tRNA N6-adenosine threonylcarbamoyltransferase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=kae1 PE=3 SV=1 | 1 | 263 | 8.0E-54 |
sp|A8A948|KAE1_IGNH4 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=kae1 PE=3 SV=1 | 1 | 262 | 1.0E-53 |
sp|A3DMS9|KAE1_STAMF | tRNA N6-adenosine threonylcarbamoyltransferase OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=kae1 PE=3 SV=1 | 1 | 262 | 4.0E-53 |
sp|Q9YCX7|KAE1_AERPE | tRNA N6-adenosine threonylcarbamoyltransferase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=kae1 PE=3 SV=1 | 1 | 262 | 5.0E-53 |
sp|Q8ZV67|KAE1_PYRAE | tRNA N6-adenosine threonylcarbamoyltransferase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=kae1 PE=3 SV=1 | 1 | 262 | 4.0E-45 |
sp|A3MSX6|KAE1_PYRCJ | tRNA N6-adenosine threonylcarbamoyltransferase OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=kae1 PE=3 SV=1 | 1 | 262 | 8.0E-44 |
sp|Q74M58|KAE1_NANEQ | tRNA N6-adenosine threonylcarbamoyltransferase OS=Nanoarchaeum equitans (strain Kin4-M) GN=kae1 PE=3 SV=1 | 20 | 239 | 1.0E-43 |
sp|A4WKT1|KAE1_PYRAR | tRNA N6-adenosine threonylcarbamoyltransferase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=kae1 PE=3 SV=1 | 1 | 262 | 3.0E-43 |
sp|A1RVQ8|KAE1_PYRIL | tRNA N6-adenosine threonylcarbamoyltransferase OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=kae1 PE=3 SV=1 | 1 | 262 | 3.0E-41 |
sp|B1Y8P8|KAE1_PYRNV | tRNA N6-adenosine threonylcarbamoyltransferase OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=kae1 PE=3 SV=1 | 1 | 264 | 2.0E-38 |
sp|B8GPT9|TSAD_THISH | tRNA N6-adenosine threonylcarbamoyltransferase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=tsaD PE=3 SV=1 | 1 | 240 | 2.0E-29 |
sp|A8GJV1|TSAD_SERP5 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Serratia proteamaculans (strain 568) GN=tsaD PE=3 SV=1 | 9 | 244 | 4.0E-28 |
sp|Q9L7A5|TSAD_HAEDU | tRNA N6-adenosine threonylcarbamoyltransferase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=tsaD PE=3 SV=1 | 9 | 244 | 5.0E-28 |
sp|B8F7W7|TSAD_HAEPS | tRNA N6-adenosine threonylcarbamoyltransferase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=tsaD PE=3 SV=1 | 12 | 244 | 8.0E-28 |
sp|B0USH5|TSAD_HISS2 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Histophilus somni (strain 2336) GN=tsaD PE=3 SV=1 | 12 | 244 | 1.0E-27 |
sp|A8H152|TSAD_SHEPA | tRNA N6-adenosine threonylcarbamoyltransferase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=tsaD PE=3 SV=1 | 9 | 239 | 2.0E-27 |
sp|B5XU22|TSAD_KLEP3 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Klebsiella pneumoniae (strain 342) GN=tsaD PE=3 SV=1 | 9 | 244 | 2.0E-27 |
sp|Q7NKX2|TSAD_GLOVI | tRNA N6-adenosine threonylcarbamoyltransferase OS=Gloeobacter violaceus (strain PCC 7421) GN=tsaD PE=3 SV=1 | 9 | 244 | 4.0E-27 |
sp|B1LF56|TSAD_ECOSM | tRNA N6-adenosine threonylcarbamoyltransferase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=tsaD PE=3 SV=1 | 9 | 244 | 5.0E-27 |
sp|B7VIH2|TSAD_VIBTL | tRNA N6-adenosine threonylcarbamoyltransferase OS=Vibrio tasmaniensis (strain LGP32) GN=tsaD PE=3 SV=1 | 9 | 239 | 6.0E-27 |
sp|A6TE46|TSAD_KLEP7 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=tsaD PE=3 SV=1 | 9 | 244 | 6.0E-27 |
sp|B0BQ60|TSAD_ACTPJ | tRNA N6-adenosine threonylcarbamoyltransferase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=tsaD PE=3 SV=1 | 9 | 244 | 7.0E-27 |
sp|B3GY07|TSAD_ACTP7 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=tsaD PE=3 SV=1 | 9 | 244 | 7.0E-27 |
sp|A3N1C4|TSAD_ACTP2 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=tsaD PE=3 SV=1 | 9 | 244 | 7.0E-27 |
sp|B0TIN7|TSAD_SHEHH | tRNA N6-adenosine threonylcarbamoyltransferase OS=Shewanella halifaxensis (strain HAW-EB4) GN=tsaD PE=3 SV=1 | 9 | 239 | 8.0E-27 |
sp|B1KHE2|TSAD_SHEWM | tRNA N6-adenosine threonylcarbamoyltransferase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=tsaD PE=3 SV=1 | 9 | 239 | 9.0E-27 |
sp|P43764|TSAD_HAEIN | tRNA N6-adenosine threonylcarbamoyltransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=tsaD PE=3 SV=1 | 9 | 244 | 1.0E-26 |
sp|B7UIX2|TSAD_ECO27 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=tsaD PE=3 SV=1 | 9 | 244 | 1.0E-26 |
sp|Q3YXH9|TSAD_SHISS | tRNA N6-adenosine threonylcarbamoyltransferase OS=Shigella sonnei (strain Ss046) GN=tsaD PE=3 SV=1 | 9 | 244 | 1.0E-26 |
sp|Q83Q42|TSAD_SHIFL | tRNA N6-adenosine threonylcarbamoyltransferase OS=Shigella flexneri GN=tsaD PE=3 SV=1 | 9 | 244 | 1.0E-26 |
sp|Q0T0J9|TSAD_SHIF8 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Shigella flexneri serotype 5b (strain 8401) GN=tsaD PE=3 SV=1 | 9 | 244 | 1.0E-26 |
sp|Q31WX0|TSAD_SHIBS | tRNA N6-adenosine threonylcarbamoyltransferase OS=Shigella boydii serotype 4 (strain Sb227) GN=tsaD PE=3 SV=1 | 9 | 244 | 1.0E-26 |
sp|B2U1G7|TSAD_SHIB3 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=tsaD PE=3 SV=1 | 9 | 244 | 1.0E-26 |
sp|B7LQD8|TSAD_ESCF3 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=tsaD PE=3 SV=1 | 9 | 244 | 1.0E-26 |
sp|B6I436|TSAD_ECOSE | tRNA N6-adenosine threonylcarbamoyltransferase OS=Escherichia coli (strain SE11) GN=tsaD PE=3 SV=1 | 9 | 244 | 1.0E-26 |
sp|B1IRQ2|TSAD_ECOLC | tRNA N6-adenosine threonylcarbamoyltransferase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=tsaD PE=3 SV=1 | 9 | 244 | 1.0E-26 |
sp|A8A4M1|TSAD_ECOHS | tRNA N6-adenosine threonylcarbamoyltransferase OS=Escherichia coli O9:H4 (strain HS) GN=tsaD PE=3 SV=1 | 9 | 244 | 1.0E-26 |
sp|B7LZL4|TSAD_ECO8A | tRNA N6-adenosine threonylcarbamoyltransferase OS=Escherichia coli O8 (strain IAI1) GN=tsaD PE=3 SV=1 | 9 | 244 | 1.0E-26 |
sp|B7NJS7|TSAD_ECO7I | tRNA N6-adenosine threonylcarbamoyltransferase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=tsaD PE=3 SV=1 | 9 | 244 | 1.0E-26 |
sp|B5YRA4|TSAD_ECO5E | tRNA N6-adenosine threonylcarbamoyltransferase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=tsaD PE=3 SV=1 | 9 | 244 | 1.0E-26 |
sp|B7LGZ9|TSAD_ECO55 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Escherichia coli (strain 55989 / EAEC) GN=tsaD PE=3 SV=1 | 9 | 244 | 1.0E-26 |
sp|A7ZRU6|TSAD_ECO24 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=tsaD PE=3 SV=1 | 9 | 244 | 1.0E-26 |
sp|A1JQW9|TSAD_YERE8 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=tsaD PE=3 SV=1 | 9 | 244 | 1.0E-26 |
sp|B8CJF1|TSAD_SHEPW | tRNA N6-adenosine threonylcarbamoyltransferase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=tsaD PE=3 SV=1 | 9 | 239 | 1.0E-26 |
sp|Q32BQ3|TSAD_SHIDS | tRNA N6-adenosine threonylcarbamoyltransferase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=tsaD PE=3 SV=1 | 9 | 244 | 2.0E-26 |
sp|B7ND53|TSAD_ECOLU | tRNA N6-adenosine threonylcarbamoyltransferase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=tsaD PE=3 SV=1 | 9 | 244 | 2.0E-26 |
sp|P05852|TSAD_ECOLI | tRNA N6-adenosine threonylcarbamoyltransferase OS=Escherichia coli (strain K12) GN=tsaD PE=1 SV=2 | 9 | 244 | 2.0E-26 |
sp|B1XG69|TSAD_ECODH | tRNA N6-adenosine threonylcarbamoyltransferase OS=Escherichia coli (strain K12 / DH10B) GN=tsaD PE=3 SV=1 | 9 | 244 | 2.0E-26 |
sp|C4ZQY1|TSAD_ECOBW | tRNA N6-adenosine threonylcarbamoyltransferase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=tsaD PE=3 SV=1 | 9 | 244 | 2.0E-26 |
sp|Q1R6R7|TSAD_ECOUT | tRNA N6-adenosine threonylcarbamoyltransferase OS=Escherichia coli (strain UTI89 / UPEC) GN=tsaD PE=3 SV=1 | 9 | 244 | 2.0E-26 |
sp|Q8FDG6|TSAD_ECOL6 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=tsaD PE=3 SV=1 | 9 | 244 | 2.0E-26 |
sp|Q0TD42|TSAD_ECOL5 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=tsaD PE=3 SV=1 | 9 | 244 | 2.0E-26 |
sp|A1AFY6|TSAD_ECOK1 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Escherichia coli O1:K1 / APEC GN=tsaD PE=3 SV=1 | 9 | 244 | 2.0E-26 |
sp|B7N068|TSAD_ECO81 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Escherichia coli O81 (strain ED1a) GN=tsaD PE=3 SV=1 | 9 | 244 | 2.0E-26 |
sp|B7MB00|TSAD_ECO45 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=tsaD PE=3 SV=1 | 9 | 244 | 2.0E-26 |
sp|Q87SL5|TSAD_VIBPA | tRNA N6-adenosine threonylcarbamoyltransferase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=tsaD PE=3 SV=1 | 9 | 239 | 2.0E-26 |
sp|C3LS11|TSAD_VIBCM | tRNA N6-adenosine threonylcarbamoyltransferase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=tsaD PE=3 SV=1 | 9 | 239 | 4.0E-26 |
sp|A5F9E8|TSAD_VIBC3 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=tsaD PE=3 SV=1 | 9 | 239 | 4.0E-26 |
sp|Q8XBK3|TSAD_ECO57 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Escherichia coli O157:H7 GN=tsaD PE=3 SV=1 | 9 | 244 | 4.0E-26 |
sp|B5YDS4|TSAD_DICT6 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=tsaD PE=3 SV=1 | 11 | 244 | 5.0E-26 |
sp|A4SZK1|TSAD_POLSQ | tRNA N6-adenosine threonylcarbamoyltransferase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=tsaD PE=3 SV=1 | 12 | 242 | 5.0E-26 |
sp|A7MJU0|TSAD_CROS8 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=tsaD PE=3 SV=1 | 9 | 237 | 6.0E-26 |
sp|A6VQW2|TSAD_ACTSZ | tRNA N6-adenosine threonylcarbamoyltransferase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=tsaD PE=3 SV=1 | 9 | 244 | 1.0E-25 |
sp|A9L5I3|TSAD_SHEB9 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Shewanella baltica (strain OS195) GN=tsaD PE=3 SV=1 | 9 | 244 | 1.0E-25 |
sp|A6WKK4|TSAD_SHEB8 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Shewanella baltica (strain OS185) GN=tsaD PE=3 SV=1 | 9 | 244 | 1.0E-25 |
sp|B8EBV5|TSAD_SHEB2 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Shewanella baltica (strain OS223) GN=tsaD PE=3 SV=1 | 9 | 244 | 1.0E-25 |
sp|A8FS64|TSAD_SHESH | tRNA N6-adenosine threonylcarbamoyltransferase OS=Shewanella sediminis (strain HAW-EB3) GN=tsaD PE=3 SV=1 | 9 | 239 | 2.0E-25 |
sp|Q7MNZ9|TSAD_VIBVY | tRNA N6-adenosine threonylcarbamoyltransferase OS=Vibrio vulnificus (strain YJ016) GN=tsaD PE=3 SV=1 | 9 | 238 | 2.0E-25 |
sp|Q8DEG4|TSAD_VIBVU | tRNA N6-adenosine threonylcarbamoyltransferase OS=Vibrio vulnificus (strain CMCP6) GN=tsaD PE=3 SV=1 | 9 | 238 | 2.0E-25 |
sp|B1JM18|TSAD_YERPY | tRNA N6-adenosine threonylcarbamoyltransferase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=tsaD PE=3 SV=1 | 9 | 244 | 2.0E-25 |
sp|Q665U5|TSAD_YERPS | tRNA N6-adenosine threonylcarbamoyltransferase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=tsaD PE=3 SV=1 | 9 | 244 | 2.0E-25 |
sp|A4THT1|TSAD_YERPP | tRNA N6-adenosine threonylcarbamoyltransferase OS=Yersinia pestis (strain Pestoides F) GN=tsaD PE=3 SV=1 | 9 | 244 | 2.0E-25 |
sp|Q1CME2|TSAD_YERPN | tRNA N6-adenosine threonylcarbamoyltransferase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=tsaD PE=3 SV=1 | 9 | 244 | 2.0E-25 |
sp|A9R7E3|TSAD_YERPG | tRNA N6-adenosine threonylcarbamoyltransferase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=tsaD PE=3 SV=1 | 9 | 244 | 2.0E-25 |
sp|Q74RQ9|TSAD_YERPE | tRNA N6-adenosine threonylcarbamoyltransferase OS=Yersinia pestis GN=tsaD PE=3 SV=1 | 9 | 244 | 2.0E-25 |
sp|B2K2I3|TSAD_YERPB | tRNA N6-adenosine threonylcarbamoyltransferase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=tsaD PE=3 SV=1 | 9 | 244 | 2.0E-25 |
sp|Q1C366|TSAD_YERPA | tRNA N6-adenosine threonylcarbamoyltransferase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=tsaD PE=3 SV=1 | 9 | 244 | 2.0E-25 |
sp|A7FE71|TSAD_YERP3 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=tsaD PE=3 SV=1 | 9 | 244 | 2.0E-25 |
sp|A9MPV5|TSAD_SALAR | tRNA N6-adenosine threonylcarbamoyltransferase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=tsaD PE=3 SV=1 | 9 | 239 | 3.0E-25 |
sp|A8APV4|TSAD_CITK8 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=tsaD PE=3 SV=1 | 9 | 244 | 3.0E-25 |
sp|A3D1Q4|TSAD_SHEB5 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=tsaD PE=3 SV=1 | 9 | 239 | 3.0E-25 |
sp|A3QBM3|TSAD_SHELP | tRNA N6-adenosine threonylcarbamoyltransferase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=tsaD PE=3 SV=1 | 9 | 244 | 3.0E-25 |
sp|B2VGJ0|TSAD_ERWT9 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=tsaD PE=3 SV=1 | 9 | 244 | 4.0E-25 |
sp|Q0HSD5|TSAD_SHESR | tRNA N6-adenosine threonylcarbamoyltransferase OS=Shewanella sp. (strain MR-7) GN=tsaD PE=3 SV=1 | 9 | 244 | 4.0E-25 |
sp|Q0HG42|TSAD_SHESM | tRNA N6-adenosine threonylcarbamoyltransferase OS=Shewanella sp. (strain MR-4) GN=tsaD PE=3 SV=1 | 9 | 244 | 4.0E-25 |
sp|A0KZT8|TSAD_SHESA | tRNA N6-adenosine threonylcarbamoyltransferase OS=Shewanella sp. (strain ANA-3) GN=tsaD PE=3 SV=1 | 9 | 244 | 4.0E-25 |
sp|Q65RP0|TSAD_MANSM | tRNA N6-adenosine threonylcarbamoyltransferase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=tsaD PE=3 SV=1 | 12 | 244 | 6.0E-25 |
sp|P40731|TSAD_SALTY | tRNA N6-adenosine threonylcarbamoyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=tsaD PE=3 SV=2 | 9 | 239 | 6.0E-25 |
sp|B4TI59|TSAD_SALHS | tRNA N6-adenosine threonylcarbamoyltransferase OS=Salmonella heidelberg (strain SL476) GN=tsaD PE=3 SV=1 | 9 | 239 | 6.0E-25 |
sp|B5REG6|TSAD_SALG2 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=tsaD PE=3 SV=1 | 9 | 239 | 6.0E-25 |
sp|B5QZ44|TSAD_SALEP | tRNA N6-adenosine threonylcarbamoyltransferase OS=Salmonella enteritidis PT4 (strain P125109) GN=tsaD PE=3 SV=1 | 9 | 239 | 6.0E-25 |
sp|B5FHU3|TSAD_SALDC | tRNA N6-adenosine threonylcarbamoyltransferase OS=Salmonella dublin (strain CT_02021853) GN=tsaD PE=3 SV=1 | 9 | 239 | 6.0E-25 |
sp|B5F6A4|TSAD_SALA4 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Salmonella agona (strain SL483) GN=tsaD PE=3 SV=1 | 9 | 239 | 6.0E-25 |
sp|P36175|TSAD_MANHA | tRNA N6-adenosine threonylcarbamoyltransferase OS=Mannheimia haemolytica GN=tsaD PE=1 SV=1 | 9 | 238 | 6.0E-25 |
sp|A9N5Y7|TSAD_SALPB | tRNA N6-adenosine threonylcarbamoyltransferase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=tsaD PE=3 SV=1 | 9 | 239 | 7.0E-25 |
sp|B4T678|TSAD_SALNS | tRNA N6-adenosine threonylcarbamoyltransferase OS=Salmonella newport (strain SL254) GN=tsaD PE=3 SV=1 | 9 | 239 | 7.0E-25 |
sp|A1S3S8|TSAD_SHEAM | tRNA N6-adenosine threonylcarbamoyltransferase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=tsaD PE=3 SV=1 | 9 | 239 | 7.0E-25 |
sp|B4TVU2|TSAD_SALSV | tRNA N6-adenosine threonylcarbamoyltransferase OS=Salmonella schwarzengrund (strain CVM19633) GN=tsaD PE=3 SV=1 | 9 | 239 | 9.0E-25 |
sp|Q8Z3M6|TSAD_SALTI | tRNA N6-adenosine threonylcarbamoyltransferase OS=Salmonella typhi GN=tsaD PE=3 SV=1 | 9 | 239 | 9.0E-25 |
sp|B5BG20|TSAD_SALPK | tRNA N6-adenosine threonylcarbamoyltransferase OS=Salmonella paratyphi A (strain AKU_12601) GN=tsaD PE=3 SV=1 | 9 | 239 | 1.0E-24 |
sp|C0PYY1|TSAD_SALPC | tRNA N6-adenosine threonylcarbamoyltransferase OS=Salmonella paratyphi C (strain RKS4594) GN=tsaD PE=3 SV=1 | 9 | 239 | 1.0E-24 |
sp|Q5PKX9|TSAD_SALPA | tRNA N6-adenosine threonylcarbamoyltransferase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=tsaD PE=3 SV=1 | 9 | 239 | 1.0E-24 |
sp|Q57JQ1|TSAD_SALCH | tRNA N6-adenosine threonylcarbamoyltransferase OS=Salmonella choleraesuis (strain SC-B67) GN=tsaD PE=3 SV=1 | 9 | 239 | 1.0E-24 |
sp|C4K3R9|TSAD_HAMD5 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=tsaD PE=3 SV=1 | 1 | 244 | 1.0E-24 |
sp|A7HGZ6|TSAD_ANADF | tRNA N6-adenosine threonylcarbamoyltransferase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=tsaD PE=3 SV=1 | 1 | 241 | 1.0E-24 |
sp|Q65N07|TSAD_BACLD | tRNA N6-adenosine threonylcarbamoyltransferase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=tsaD PE=3 SV=1 | 11 | 241 | 1.0E-24 |
sp|Q3AE55|TSAD_CARHZ | tRNA N6-adenosine threonylcarbamoyltransferase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=tsaD PE=3 SV=1 | 1 | 244 | 2.0E-24 |
sp|B8E1B4|TSAD_DICTD | tRNA N6-adenosine threonylcarbamoyltransferase OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=tsaD PE=3 SV=1 | 10 | 244 | 2.0E-24 |
sp|Q12KB7|TSAD_SHEDO | tRNA N6-adenosine threonylcarbamoyltransferase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=tsaD PE=3 SV=1 | 9 | 239 | 2.0E-24 |
sp|A4Y4F3|TSAD_SHEPC | tRNA N6-adenosine threonylcarbamoyltransferase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=tsaD PE=3 SV=1 | 9 | 244 | 2.0E-24 |
sp|A5WCC7|TSAD_PSYWF | tRNA N6-adenosine threonylcarbamoyltransferase OS=Psychrobacter sp. (strain PRwf-1) GN=tsaD PE=3 SV=1 | 1 | 258 | 2.0E-24 |
sp|C5BHG1|TSAD_EDWI9 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Edwardsiella ictaluri (strain 93-146) GN=tsaD PE=3 SV=1 | 9 | 239 | 2.0E-24 |
sp|Q6FCK9|TSAD_ACIAD | tRNA N6-adenosine threonylcarbamoyltransferase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=tsaD PE=3 SV=1 | 1 | 239 | 3.0E-24 |
sp|Q8EHD6|TSAD_SHEON | tRNA N6-adenosine threonylcarbamoyltransferase OS=Shewanella oneidensis (strain MR-1) GN=tsaD PE=3 SV=1 | 9 | 244 | 4.0E-24 |
sp|B0V811|TSAD_ACIBY | tRNA N6-adenosine threonylcarbamoyltransferase OS=Acinetobacter baumannii (strain AYE) GN=tsaD PE=3 SV=1 | 1 | 239 | 4.0E-24 |
sp|B2HUS7|TSAD_ACIBC | tRNA N6-adenosine threonylcarbamoyltransferase OS=Acinetobacter baumannii (strain ACICU) GN=tsaD PE=3 SV=1 | 1 | 239 | 4.0E-24 |
sp|B7I2K6|TSAD_ACIB5 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Acinetobacter baumannii (strain AB0057) GN=tsaD PE=3 SV=1 | 1 | 239 | 4.0E-24 |
sp|B7H0A7|TSAD_ACIB3 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Acinetobacter baumannii (strain AB307-0294) GN=tsaD PE=3 SV=1 | 1 | 239 | 4.0E-24 |
sp|C4LB59|TSAD_TOLAT | tRNA N6-adenosine threonylcarbamoyltransferase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=tsaD PE=3 SV=1 | 9 | 244 | 5.0E-24 |
sp|B0VKC7|TSAD_ACIBS | tRNA N6-adenosine threonylcarbamoyltransferase OS=Acinetobacter baumannii (strain SDF) GN=tsaD PE=3 SV=1 | 1 | 239 | 6.0E-24 |
sp|Q1QYX8|TSAD_CHRSD | tRNA N6-adenosine threonylcarbamoyltransferase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=tsaD PE=3 SV=1 | 9 | 241 | 1.0E-23 |
sp|O66986|TSAD_AQUAE | tRNA N6-adenosine threonylcarbamoyltransferase OS=Aquifex aeolicus (strain VF5) GN=tsaD PE=3 SV=1 | 12 | 244 | 1.0E-23 |
sp|B4RY33|TSAD_ALTMD | tRNA N6-adenosine threonylcarbamoyltransferase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=tsaD PE=3 SV=1 | 1 | 259 | 1.0E-23 |
sp|Q3IHX1|TSAD_PSEHT | tRNA N6-adenosine threonylcarbamoyltransferase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=tsaD PE=3 SV=1 | 1 | 258 | 2.0E-23 |
sp|A0KGI3|TSAD_AERHH | tRNA N6-adenosine threonylcarbamoyltransferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=tsaD PE=3 SV=1 | 9 | 244 | 2.0E-23 |
sp|Q5QY46|TSAD_IDILO | tRNA N6-adenosine threonylcarbamoyltransferase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=tsaD PE=3 SV=1 | 9 | 244 | 2.0E-23 |
sp|Q21MU7|TSAD_SACD2 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=tsaD PE=3 SV=1 | 13 | 244 | 3.0E-23 |
sp|B4SHI9|TSAD_STRM5 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Stenotrophomonas maltophilia (strain R551-3) GN=tsaD PE=3 SV=1 | 1 | 243 | 3.0E-23 |
sp|Q0VMU1|TSAD_ALCBS | tRNA N6-adenosine threonylcarbamoyltransferase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=tsaD PE=3 SV=1 | 12 | 245 | 3.0E-23 |
sp|A1SRR5|TSAD_PSYIN | tRNA N6-adenosine threonylcarbamoyltransferase OS=Psychromonas ingrahamii (strain 37) GN=tsaD PE=3 SV=1 | 13 | 239 | 4.0E-23 |
sp|B4EW57|TSAD_PROMH | tRNA N6-adenosine threonylcarbamoyltransferase OS=Proteus mirabilis (strain HI4320) GN=tsaD PE=3 SV=1 | 9 | 244 | 4.0E-23 |
sp|C6DKG9|TSAD_PECCP | tRNA N6-adenosine threonylcarbamoyltransferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=tsaD PE=3 SV=1 | 9 | 244 | 4.0E-23 |
sp|A4SRB1|TSAD_AERS4 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Aeromonas salmonicida (strain A449) GN=tsaD PE=3 SV=1 | 9 | 244 | 4.0E-23 |
sp|Q2GEG6|TSAD_NEOSM | tRNA N6-adenosine threonylcarbamoyltransferase OS=Neorickettsia sennetsu (strain Miyayama) GN=tsaD PE=3 SV=1 | 12 | 239 | 5.0E-23 |
sp|A1WZH8|TSAD_HALHL | tRNA N6-adenosine threonylcarbamoyltransferase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=tsaD PE=3 SV=1 | 12 | 244 | 5.0E-23 |
sp|Q47IP4|TSAD_DECAR | tRNA N6-adenosine threonylcarbamoyltransferase OS=Dechloromonas aromatica (strain RCB) GN=tsaD PE=3 SV=2 | 12 | 251 | 5.0E-23 |
sp|Q2NWE6|TSAD_SODGM | tRNA N6-adenosine threonylcarbamoyltransferase OS=Sodalis glossinidius (strain morsitans) GN=tsaD PE=3 SV=1 | 9 | 244 | 6.0E-23 |
sp|A4XZK6|TSAD_PSEMY | tRNA N6-adenosine threonylcarbamoyltransferase OS=Pseudomonas mendocina (strain ymp) GN=tsaD PE=3 SV=1 | 9 | 244 | 7.0E-23 |
sp|B2FK06|TSAD_STRMK | tRNA N6-adenosine threonylcarbamoyltransferase OS=Stenotrophomonas maltophilia (strain K279a) GN=tsaD PE=3 SV=1 | 1 | 243 | 7.0E-23 |
sp|B1XVZ2|TSAD_POLNS | tRNA N6-adenosine threonylcarbamoyltransferase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=tsaD PE=3 SV=1 | 12 | 242 | 8.0E-23 |
sp|A0R8V9|TSAD_BACAH | tRNA N6-adenosine threonylcarbamoyltransferase OS=Bacillus thuringiensis (strain Al Hakam) GN=tsaD PE=3 SV=1 | 11 | 244 | 8.0E-23 |
sp|Q6HPD3|TSAD_BACHK | tRNA N6-adenosine threonylcarbamoyltransferase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=tsaD PE=3 SV=1 | 1 | 244 | 8.0E-23 |
sp|A5VXI4|TSAD_PSEP1 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=tsaD PE=3 SV=1 | 9 | 232 | 9.0E-23 |
sp|Q73ES6|TSAD_BACC1 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=tsaD PE=3 SV=2 | 11 | 244 | 9.0E-23 |
sp|A4WEJ9|TSAD_ENT38 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Enterobacter sp. (strain 638) GN=tsaD PE=3 SV=1 | 9 | 244 | 1.0E-22 |
sp|O05518|TSAD_BACSU | tRNA N6-adenosine threonylcarbamoyltransferase OS=Bacillus subtilis (strain 168) GN=tsaD PE=1 SV=1 | 1 | 241 | 1.0E-22 |
sp|Q4FV71|TSAD_PSYA2 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=tsaD PE=3 SV=1 | 1 | 253 | 1.0E-22 |
sp|B9K6Y6|TSAD_THENN | tRNA N6-adenosine threonylcarbamoyltransferase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=tsaD PE=3 SV=1 | 11 | 244 | 2.0E-22 |
sp|Q6D9D3|TSAD_PECAS | tRNA N6-adenosine threonylcarbamoyltransferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=tsaD PE=3 SV=1 | 9 | 244 | 2.0E-22 |
sp|Q63GW2|TSAD_BACCZ | tRNA N6-adenosine threonylcarbamoyltransferase OS=Bacillus cereus (strain ZK / E33L) GN=tsaD PE=3 SV=1 | 11 | 244 | 2.0E-22 |
sp|Q6I4E9|TSAD_BACAN | tRNA N6-adenosine threonylcarbamoyltransferase OS=Bacillus anthracis GN=tsaD PE=3 SV=1 | 11 | 244 | 2.0E-22 |
sp|Q1IG31|TSAD_PSEE4 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Pseudomonas entomophila (strain L48) GN=tsaD PE=3 SV=1 | 9 | 232 | 2.0E-22 |
sp|Q5WJP5|TSAD_BACSK | tRNA N6-adenosine threonylcarbamoyltransferase OS=Bacillus clausii (strain KSM-K16) GN=tsaD PE=3 SV=1 | 11 | 228 | 2.0E-22 |
sp|A0L5L8|TSAD_MAGMM | tRNA N6-adenosine threonylcarbamoyltransferase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=tsaD PE=3 SV=1 | 1 | 233 | 3.0E-22 |
sp|B5FB82|TSAD_VIBFM | tRNA N6-adenosine threonylcarbamoyltransferase OS=Vibrio fischeri (strain MJ11) GN=tsaD PE=3 SV=1 | 13 | 244 | 3.0E-22 |
sp|B1JDY5|TSAD_PSEPW | tRNA N6-adenosine threonylcarbamoyltransferase OS=Pseudomonas putida (strain W619) GN=tsaD PE=3 SV=1 | 9 | 244 | 8.0E-22 |
sp|Q88QU6|TSAD_PSEPK | tRNA N6-adenosine threonylcarbamoyltransferase OS=Pseudomonas putida (strain KT2440) GN=tsaD PE=3 SV=1 | 9 | 232 | 8.0E-22 |
sp|C1DIY3|TSAD_AZOVD | tRNA N6-adenosine threonylcarbamoyltransferase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=tsaD PE=3 SV=1 | 9 | 241 | 9.0E-22 |
sp|B6EM15|TSAD_ALISL | tRNA N6-adenosine threonylcarbamoyltransferase OS=Aliivibrio salmonicida (strain LFI1238) GN=tsaD PE=3 SV=1 | 13 | 244 | 9.0E-22 |
sp|Q31EM1|TSAD_THICR | tRNA N6-adenosine threonylcarbamoyltransferase OS=Thiomicrospira crunogena (strain XCL-2) GN=tsaD PE=3 SV=1 | 1 | 232 | 1.0E-21 |
sp|Q81IS8|TSAD_BACCR | tRNA N6-adenosine threonylcarbamoyltransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=tsaD PE=3 SV=1 | 11 | 244 | 1.0E-21 |
sp|Q67K94|TSAD_SYMTH | tRNA N6-adenosine threonylcarbamoyltransferase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=tsaD PE=3 SV=1 | 11 | 241 | 1.0E-21 |
sp|A4VHG9|TSAD_PSEU5 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Pseudomonas stutzeri (strain A1501) GN=tsaD PE=3 SV=2 | 9 | 232 | 1.0E-21 |
sp|B0TX13|TSAD_FRAP2 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=tsaD PE=3 SV=1 | 9 | 232 | 1.0E-21 |
sp|C1A601|TSAD_GEMAT | tRNA N6-adenosine threonylcarbamoyltransferase OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=tsaD PE=3 SV=1 | 12 | 239 | 1.0E-21 |
sp|C1DB12|TSAD_LARHH | tRNA N6-adenosine threonylcarbamoyltransferase OS=Laribacter hongkongensis (strain HLHK9) GN=tsaD PE=3 SV=1 | 1 | 237 | 1.0E-21 |
sp|Q47W35|TSAD_COLP3 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=tsaD PE=3 SV=1 | 13 | 239 | 2.0E-21 |
sp|Q6LV10|TSAD_PHOPR | tRNA N6-adenosine threonylcarbamoyltransferase OS=Photobacterium profundum GN=tsaD PE=3 SV=1 | 9 | 233 | 3.0E-21 |
sp|A6LKP0|TSAD_THEM4 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=tsaD PE=3 SV=1 | 1 | 236 | 3.0E-21 |
sp|Q4ZMF4|TSAD_PSEU2 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=tsaD PE=3 SV=1 | 9 | 247 | 4.0E-21 |
sp|Q1QE85|TSAD_PSYCK | tRNA N6-adenosine threonylcarbamoyltransferase OS=Psychrobacter cryohalolentis (strain K5) GN=tsaD PE=3 SV=1 | 1 | 258 | 6.0E-21 |
sp|Q8XX97|TSAD_RALSO | tRNA N6-adenosine threonylcarbamoyltransferase OS=Ralstonia solanacearum (strain GMI1000) GN=tsaD PE=3 SV=1 | 2 | 232 | 6.0E-21 |
sp|A8LP83|TSAD_DINSH | tRNA N6-adenosine threonylcarbamoyltransferase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=tsaD PE=3 SV=1 | 22 | 244 | 7.0E-21 |
sp|B0KJ82|TSAD_PSEPG | tRNA N6-adenosine threonylcarbamoyltransferase OS=Pseudomonas putida (strain GB-1) GN=tsaD PE=3 SV=1 | 9 | 232 | 7.0E-21 |
sp|Q7N0B6|TSAD_PHOLL | tRNA N6-adenosine threonylcarbamoyltransferase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=tsaD PE=3 SV=1 | 9 | 237 | 7.0E-21 |
sp|A6UZ83|TSAD_PSEA7 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Pseudomonas aeruginosa (strain PA7) GN=tsaD PE=3 SV=1 | 9 | 232 | 8.0E-21 |
sp|Q4K4W4|TSAD_PSEF5 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=tsaD PE=3 SV=1 | 9 | 244 | 9.0E-21 |
sp|Q493X8|TSAD_BLOPB | tRNA N6-adenosine threonylcarbamoyltransferase OS=Blochmannia pennsylvanicus (strain BPEN) GN=tsaD PE=3 SV=1 | 1 | 245 | 9.0E-21 |
sp|Q24QC9|TSAD_DESHY | tRNA N6-adenosine threonylcarbamoyltransferase OS=Desulfitobacterium hafniense (strain Y51) GN=tsaD PE=3 SV=1 | 1 | 232 | 1.0E-20 |
sp|A7HLB0|TSAD_FERNB | tRNA N6-adenosine threonylcarbamoyltransferase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=tsaD PE=3 SV=1 | 1 | 246 | 1.0E-20 |
sp|Q49Z04|TSAD_STAS1 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=tsaD PE=3 SV=1 | 1 | 239 | 1.0E-20 |
sp|Q0A5M7|TSAD_ALKEH | tRNA N6-adenosine threonylcarbamoyltransferase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=tsaD PE=3 SV=1 | 12 | 246 | 1.0E-20 |
sp|Q87B17|TSAD_XYLFT | tRNA N6-adenosine threonylcarbamoyltransferase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=tsaD PE=3 SV=1 | 1 | 242 | 2.0E-20 |
sp|B0U4B5|TSAD_XYLFM | tRNA N6-adenosine threonylcarbamoyltransferase OS=Xylella fastidiosa (strain M12) GN=tsaD PE=3 SV=1 | 1 | 242 | 2.0E-20 |
sp|B2I7X4|TSAD_XYLF2 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Xylella fastidiosa (strain M23) GN=tsaD PE=3 SV=1 | 1 | 242 | 2.0E-20 |
sp|C5BPQ9|TSAD_TERTT | tRNA N6-adenosine threonylcarbamoyltransferase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=tsaD PE=3 SV=1 | 13 | 232 | 2.0E-20 |
sp|Q3K5S1|TSAD_PSEPF | tRNA N6-adenosine threonylcarbamoyltransferase OS=Pseudomonas fluorescens (strain Pf0-1) GN=tsaD PE=3 SV=1 | 9 | 244 | 2.0E-20 |
sp|Q7NUE3|TSAD_CHRVO | tRNA N6-adenosine threonylcarbamoyltransferase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=tsaD PE=3 SV=1 | 1 | 237 | 2.0E-20 |
sp|Q9I5V7|TSAD_PSEAE | tRNA N6-adenosine threonylcarbamoyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=tsaD PE=3 SV=1 | 9 | 232 | 2.0E-20 |
sp|Q929U3|TSAD_LISIN | tRNA N6-adenosine threonylcarbamoyltransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=tsaD PE=3 SV=1 | 1 | 242 | 2.0E-20 |
sp|Q2IFU7|TSAD_ANADE | tRNA N6-adenosine threonylcarbamoyltransferase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=tsaD PE=3 SV=1 | 1 | 241 | 3.0E-20 |
sp|Q28JW5|TSAD_JANSC | tRNA N6-adenosine threonylcarbamoyltransferase OS=Jannaschia sp. (strain CCS1) GN=tsaD PE=3 SV=1 | 1 | 239 | 3.0E-20 |
sp|Q02TI3|TSAD_PSEAB | tRNA N6-adenosine threonylcarbamoyltransferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=tsaD PE=3 SV=1 | 9 | 232 | 3.0E-20 |
sp|Q48NU8|TSAD_PSE14 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=tsaD PE=3 SV=1 | 9 | 247 | 3.0E-20 |
sp|B2U928|TSAD_RALPJ | tRNA N6-adenosine threonylcarbamoyltransferase OS=Ralstonia pickettii (strain 12J) GN=tsaD PE=3 SV=1 | 2 | 232 | 3.0E-20 |
sp|Q602S1|TSAD_METCA | tRNA N6-adenosine threonylcarbamoyltransferase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=tsaD PE=3 SV=1 | 1 | 243 | 3.0E-20 |
sp|Q5GV94|TSAD_XANOR | tRNA N6-adenosine threonylcarbamoyltransferase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=tsaD PE=3 SV=1 | 1 | 241 | 3.0E-20 |
sp|B2SLA3|TSAD_XANOP | tRNA N6-adenosine threonylcarbamoyltransferase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=tsaD PE=3 SV=1 | 1 | 241 | 3.0E-20 |
sp|Q2NYH1|TSAD_XANOM | tRNA N6-adenosine threonylcarbamoyltransferase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=tsaD PE=3 SV=1 | 1 | 241 | 3.0E-20 |
sp|B8J7H2|TSAD_ANAD2 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=tsaD PE=3 SV=1 | 1 | 241 | 4.0E-20 |
sp|B1LA07|TSAD_THESQ | tRNA N6-adenosine threonylcarbamoyltransferase OS=Thermotoga sp. (strain RQ2) GN=tsaD PE=3 SV=1 | 1 | 244 | 4.0E-20 |
sp|A5IKS6|TSAD_THEP1 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=tsaD PE=3 SV=1 | 1 | 244 | 4.0E-20 |
sp|Q16CW3|TSAD_ROSDO | tRNA N6-adenosine threonylcarbamoyltransferase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=tsaD PE=3 SV=1 | 12 | 233 | 4.0E-20 |
sp|Q9WXZ2|TSAD_THEMA | tRNA N6-adenosine threonylcarbamoyltransferase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=tsaD PE=3 SV=1 | 1 | 244 | 5.0E-20 |
sp|Q3BNE2|TSAD_XANC5 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=tsaD PE=3 SV=1 | 1 | 239 | 6.0E-20 |
sp|Q9PG67|TSAD_XYLFA | tRNA N6-adenosine threonylcarbamoyltransferase OS=Xylella fastidiosa (strain 9a5c) GN=tsaD PE=3 SV=1 | 1 | 242 | 6.0E-20 |
sp|Q62DT7|TSAD_BURMA | tRNA N6-adenosine threonylcarbamoyltransferase OS=Burkholderia mallei (strain ATCC 23344) GN=tsaD PE=3 SV=1 | 12 | 248 | 6.0E-20 |
sp|A1TYE0|TSAD_MARHV | tRNA N6-adenosine threonylcarbamoyltransferase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=tsaD PE=3 SV=1 | 12 | 241 | 6.0E-20 |
sp|B3PKA5|TSAD_CELJU | tRNA N6-adenosine threonylcarbamoyltransferase OS=Cellvibrio japonicus (strain Ueda107) GN=tsaD PE=3 SV=1 | 13 | 244 | 7.0E-20 |
sp|Q8Y5I7|TSAD_LISMO | tRNA N6-adenosine threonylcarbamoyltransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=tsaD PE=3 SV=1 | 1 | 242 | 8.0E-20 |
sp|A4IJU4|TSAD_GEOTN | tRNA N6-adenosine threonylcarbamoyltransferase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=tsaD PE=3 SV=2 | 1 | 244 | 8.0E-20 |
sp|Q8PFV1|TSAD_XANAC | tRNA N6-adenosine threonylcarbamoyltransferase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=tsaD PE=3 SV=1 | 1 | 239 | 8.0E-20 |
sp|Q71XT8|TSAD_LISMF | tRNA N6-adenosine threonylcarbamoyltransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=tsaD PE=3 SV=2 | 1 | 242 | 8.0E-20 |
sp|C1KX28|TSAD_LISMC | tRNA N6-adenosine threonylcarbamoyltransferase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=tsaD PE=3 SV=1 | 1 | 242 | 8.0E-20 |
sp|Q8ESI6|TSAD_OCEIH | tRNA N6-adenosine threonylcarbamoyltransferase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=tsaD PE=3 SV=1 | 22 | 244 | 9.0E-20 |
sp|Q2T7N3|TSAD_BURTA | tRNA N6-adenosine threonylcarbamoyltransferase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=tsaD PE=3 SV=1 | 12 | 248 | 9.0E-20 |
sp|C3K338|TSAD_PSEFS | tRNA N6-adenosine threonylcarbamoyltransferase OS=Pseudomonas fluorescens (strain SBW25) GN=tsaD PE=3 SV=1 | 9 | 244 | 9.0E-20 |
sp|Q1RH23|TSAD_RICBR | tRNA N6-adenosine threonylcarbamoyltransferase OS=Rickettsia bellii (strain RML369-C) GN=tsaD PE=3 SV=1 | 9 | 244 | 1.0E-19 |
sp|A8GU95|TSAD_RICB8 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Rickettsia bellii (strain OSU 85-389) GN=tsaD PE=3 SV=1 | 9 | 244 | 1.0E-19 |
sp|Q7V2K6|TSAD_PROMP | tRNA N6-adenosine threonylcarbamoyltransferase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=tsaD PE=3 SV=1 | 9 | 240 | 1.0E-19 |
sp|A0AKI2|TSAD_LISW6 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=tsaD PE=3 SV=2 | 1 | 242 | 1.0E-19 |
sp|Q13RW9|TSAD_BURXL | tRNA N6-adenosine threonylcarbamoyltransferase OS=Burkholderia xenovorans (strain LB400) GN=tsaD PE=3 SV=1 | 2 | 237 | 1.0E-19 |
sp|Q2Y7B6|TSAD_NITMU | tRNA N6-adenosine threonylcarbamoyltransferase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=tsaD PE=3 SV=1 | 2 | 239 | 1.0E-19 |
sp|A8G3I5|TSAD_PROM2 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Prochlorococcus marinus (strain MIT 9215) GN=tsaD PE=3 SV=1 | 9 | 237 | 1.0E-19 |
sp|Q2JXG9|TSAD_SYNJA | tRNA N6-adenosine threonylcarbamoyltransferase OS=Synechococcus sp. (strain JA-3-3Ab) GN=tsaD PE=3 SV=1 | 10 | 244 | 1.0E-19 |
sp|Q8RC98|TSAD_CALS4 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=tsaD PE=3 SV=2 | 4 | 239 | 1.0E-19 |
sp|B2JP66|TSAD_BURP8 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=tsaD PE=3 SV=1 | 9 | 234 | 1.0E-19 |
sp|A0LNI2|TSAD_SYNFM | tRNA N6-adenosine threonylcarbamoyltransferase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=tsaD PE=3 SV=1 | 22 | 242 | 2.0E-19 |
sp|Q3JKA5|TSAD_BURP1 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Burkholderia pseudomallei (strain 1710b) GN=tsaD PE=3 SV=2 | 12 | 248 | 2.0E-19 |
sp|A3P7W1|TSAD_BURP0 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Burkholderia pseudomallei (strain 1106a) GN=tsaD PE=3 SV=2 | 12 | 248 | 2.0E-19 |
sp|B2G5W6|TSAD_LACRJ | tRNA N6-adenosine threonylcarbamoyltransferase OS=Lactobacillus reuteri (strain JCM 1112) GN=tsaD PE=3 SV=1 | 10 | 244 | 2.0E-19 |
sp|A5VID8|TSAD_LACRD | tRNA N6-adenosine threonylcarbamoyltransferase OS=Lactobacillus reuteri (strain DSM 20016) GN=tsaD PE=3 SV=1 | 10 | 244 | 2.0E-19 |
sp|B3E4U4|TSAD_GEOLS | tRNA N6-adenosine threonylcarbamoyltransferase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=tsaD PE=3 SV=1 | 1 | 232 | 2.0E-19 |
sp|Q2S8V7|TSAD_HAHCH | tRNA N6-adenosine threonylcarbamoyltransferase OS=Hahella chejuensis (strain KCTC 2396) GN=tsaD PE=3 SV=2 | 1 | 244 | 2.0E-19 |
sp|Q2NJM5|TSAD_AYWBP | tRNA N6-adenosine threonylcarbamoyltransferase OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=tsaD PE=3 SV=1 | 11 | 228 | 2.0E-19 |
sp|Q1WSV5|TSAD_LACS1 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Lactobacillus salivarius (strain UCC118) GN=tsaD PE=3 SV=1 | 22 | 244 | 2.0E-19 |
sp|B7V4G6|TSAD_PSEA8 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Pseudomonas aeruginosa (strain LESB58) GN=tsaD PE=3 SV=1 | 9 | 232 | 2.0E-19 |
sp|B7IGB4|TSAD_THEAB | tRNA N6-adenosine threonylcarbamoyltransferase OS=Thermosipho africanus (strain TCF52B) GN=tsaD PE=3 SV=1 | 1 | 242 | 3.0E-19 |
sp|A1A1Q5|TSAD_BIFAA | tRNA N6-adenosine threonylcarbamoyltransferase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=tsaD PE=3 SV=1 | 12 | 246 | 3.0E-19 |
sp|B2GAG0|TSAD_LACF3 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=tsaD PE=3 SV=1 | 10 | 241 | 3.0E-19 |
sp|A0M1X3|TSAD_GRAFK | tRNA N6-adenosine threonylcarbamoyltransferase OS=Gramella forsetii (strain KT0803) GN=tsaD PE=3 SV=1 | 1 | 232 | 3.0E-19 |
sp|Q63JF6|TSAD_BURPS | tRNA N6-adenosine threonylcarbamoyltransferase OS=Burkholderia pseudomallei (strain K96243) GN=tsaD PE=3 SV=1 | 12 | 248 | 4.0E-19 |
sp|Q88A57|TSAD_PSESM | tRNA N6-adenosine threonylcarbamoyltransferase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=tsaD PE=3 SV=1 | 9 | 244 | 4.0E-19 |
sp|B7GFQ4|TSAD_ANOFW | tRNA N6-adenosine threonylcarbamoyltransferase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=tsaD PE=3 SV=1 | 11 | 244 | 4.0E-19 |
sp|A5GMV4|TSAD_SYNPW | tRNA N6-adenosine threonylcarbamoyltransferase OS=Synechococcus sp. (strain WH7803) GN=tsaD PE=3 SV=1 | 9 | 239 | 5.0E-19 |
sp|Q1LK37|TSAD_CUPMC | tRNA N6-adenosine threonylcarbamoyltransferase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=tsaD PE=3 SV=2 | 2 | 237 | 5.0E-19 |
sp|A8EXA5|TSAD_RICCK | tRNA N6-adenosine threonylcarbamoyltransferase OS=Rickettsia canadensis (strain McKiel) GN=tsaD PE=3 SV=1 | 9 | 244 | 5.0E-19 |
sp|Q8P494|TSAD_XANCP | tRNA N6-adenosine threonylcarbamoyltransferase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=tsaD PE=3 SV=1 | 1 | 239 | 6.0E-19 |
sp|B0RXI2|TSAD_XANCB | tRNA N6-adenosine threonylcarbamoyltransferase OS=Xanthomonas campestris pv. campestris (strain B100) GN=tsaD PE=3 SV=1 | 1 | 239 | 6.0E-19 |
sp|Q4UPU5|TSAD_XANC8 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=tsaD PE=3 SV=1 | 1 | 239 | 6.0E-19 |
sp|Q1GYU4|TSAD_METFK | tRNA N6-adenosine threonylcarbamoyltransferase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=tsaD PE=3 SV=1 | 2 | 232 | 7.0E-19 |
sp|Q83C88|TSAD_COXBU | tRNA N6-adenosine threonylcarbamoyltransferase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=tsaD PE=3 SV=1 | 9 | 241 | 8.0E-19 |
sp|A9NHW6|TSAD_ACHLI | tRNA N6-adenosine threonylcarbamoyltransferase OS=Acholeplasma laidlawii (strain PG-8A) GN=tsaD PE=3 SV=1 | 11 | 237 | 1.0E-18 |
sp|A4JLT6|TSAD_BURVG | tRNA N6-adenosine threonylcarbamoyltransferase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=tsaD PE=3 SV=1 | 9 | 234 | 1.0E-18 |
sp|Q03SR5|TSAD_LACBA | tRNA N6-adenosine threonylcarbamoyltransferase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=tsaD PE=3 SV=1 | 1 | 239 | 1.0E-18 |
sp|A9ANA0|TSAD_BURM1 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=tsaD PE=3 SV=1 | 12 | 234 | 1.0E-18 |
sp|Q6MQ48|TSAD_BDEBA | tRNA N6-adenosine threonylcarbamoyltransferase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=tsaD PE=3 SV=1 | 10 | 244 | 1.0E-18 |
sp|A5G3X1|TSAD_GEOUR | tRNA N6-adenosine threonylcarbamoyltransferase OS=Geobacter uraniireducens (strain Rf4) GN=tsaD PE=3 SV=1 | 2 | 232 | 1.0E-18 |
sp|B4EN31|TSAD_BURCJ | tRNA N6-adenosine threonylcarbamoyltransferase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=tsaD PE=3 SV=1 | 9 | 234 | 1.0E-18 |
sp|Q74C11|TSAD_GEOSL | tRNA N6-adenosine threonylcarbamoyltransferase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=tsaD PE=3 SV=1 | 2 | 244 | 2.0E-18 |
sp|A1VD24|TSAD_DESVV | tRNA N6-adenosine threonylcarbamoyltransferase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=tsaD PE=3 SV=1 | 1 | 254 | 2.0E-18 |
sp|Q72B00|TSAD_DESVH | tRNA N6-adenosine threonylcarbamoyltransferase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=tsaD PE=3 SV=1 | 1 | 254 | 2.0E-18 |
sp|A0Q864|TSAD_FRATN | tRNA N6-adenosine threonylcarbamoyltransferase OS=Francisella tularensis subsp. novicida (strain U112) GN=tsaD PE=3 SV=1 | 9 | 241 | 2.0E-18 |
sp|Q8NVJ5|TSAD_STAAW | tRNA N6-adenosine threonylcarbamoyltransferase OS=Staphylococcus aureus (strain MW2) GN=tsaD PE=3 SV=1 | 1 | 239 | 2.0E-18 |
sp|Q6G7Q8|TSAD_STAAS | tRNA N6-adenosine threonylcarbamoyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=tsaD PE=3 SV=1 | 1 | 239 | 2.0E-18 |
sp|B9M2S8|TSAD_GEODF | tRNA N6-adenosine threonylcarbamoyltransferase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=tsaD PE=3 SV=1 | 2 | 232 | 2.0E-18 |
sp|A8Z4V2|TSAD_STAAT | tRNA N6-adenosine threonylcarbamoyltransferase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=tsaD PE=3 SV=1 | 1 | 239 | 2.0E-18 |
sp|Q6GF23|TSAD_STAAR | tRNA N6-adenosine threonylcarbamoyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=tsaD PE=3 SV=1 | 1 | 239 | 2.0E-18 |
sp|A6QIP6|TSAD_STAAE | tRNA N6-adenosine threonylcarbamoyltransferase OS=Staphylococcus aureus (strain Newman) GN=tsaD PE=3 SV=1 | 1 | 239 | 2.0E-18 |
sp|Q5HEF2|TSAD_STAAC | tRNA N6-adenosine threonylcarbamoyltransferase OS=Staphylococcus aureus (strain COL) GN=tsaD PE=3 SV=1 | 1 | 239 | 2.0E-18 |
sp|Q2FWL2|TSAD_STAA8 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Staphylococcus aureus (strain NCTC 8325) GN=tsaD PE=1 SV=1 | 1 | 239 | 2.0E-18 |
sp|Q2FF75|TSAD_STAA3 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Staphylococcus aureus (strain USA300) GN=tsaD PE=3 SV=1 | 1 | 239 | 2.0E-18 |
sp|Q5X2T1|TSAD_LEGPA | tRNA N6-adenosine threonylcarbamoyltransferase OS=Legionella pneumophila (strain Paris) GN=tsaD PE=3 SV=1 | 12 | 239 | 3.0E-18 |
sp|A1KS96|TSAD_NEIMF | tRNA N6-adenosine threonylcarbamoyltransferase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=tsaD PE=3 SV=1 | 1 | 239 | 3.0E-18 |
sp|Q5ZT08|TSAD_LEGPH | tRNA N6-adenosine threonylcarbamoyltransferase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=tsaD PE=3 SV=1 | 12 | 239 | 3.0E-18 |
sp|Q8DLI9|TSAD_THEEB | tRNA N6-adenosine threonylcarbamoyltransferase OS=Thermosynechococcus elongatus (strain BP-1) GN=tsaD PE=3 SV=1 | 10 | 244 | 3.0E-18 |
sp|A5IEF9|TSAD_LEGPC | tRNA N6-adenosine threonylcarbamoyltransferase OS=Legionella pneumophila (strain Corby) GN=tsaD PE=3 SV=1 | 12 | 239 | 3.0E-18 |
sp|Q0RM11|TSAD_FRAAA | tRNA N6-adenosine threonylcarbamoyltransferase OS=Frankia alni (strain ACN14a) GN=tsaD PE=3 SV=1 | 11 | 246 | 3.0E-18 |
sp|A3PG14|TSAD_RHOS1 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=tsaD PE=3 SV=1 | 12 | 241 | 4.0E-18 |
sp|A8GQJ1|TSAD_RICRS | tRNA N6-adenosine threonylcarbamoyltransferase OS=Rickettsia rickettsii (strain Sheila Smith) GN=tsaD PE=3 SV=1 | 9 | 244 | 4.0E-18 |
sp|B0BVX7|TSAD_RICRO | tRNA N6-adenosine threonylcarbamoyltransferase OS=Rickettsia rickettsii (strain Iowa) GN=tsaD PE=3 SV=1 | 9 | 244 | 4.0E-18 |
sp|B1Z1G4|TSAD_BURA4 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Burkholderia ambifaria (strain MC40-6) GN=tsaD PE=3 SV=1 | 9 | 234 | 4.0E-18 |
sp|C3PL61|TSAD_CORA7 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=tsaD PE=3 SV=1 | 19 | 229 | 5.0E-18 |
sp|Q2RND2|TSAD_RHORT | tRNA N6-adenosine threonylcarbamoyltransferase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=tsaD PE=3 SV=2 | 10 | 239 | 5.0E-18 |
sp|C0QTG9|TSAD_PERMH | tRNA N6-adenosine threonylcarbamoyltransferase OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=tsaD PE=3 SV=1 | 12 | 264 | 5.0E-18 |
sp|C4K157|TSAD_RICPU | tRNA N6-adenosine threonylcarbamoyltransferase OS=Rickettsia peacockii (strain Rustic) GN=tsaD PE=3 SV=1 | 9 | 244 | 5.0E-18 |
sp|Q3J6D2|TSAD_RHOS4 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=tsaD PE=3 SV=1 | 12 | 241 | 5.0E-18 |
sp|Q1LSM0|TSAD_BAUCH | tRNA N6-adenosine threonylcarbamoyltransferase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=tsaD PE=3 SV=1 | 15 | 248 | 5.0E-18 |
sp|B9JCG8|TSAD_AGRRK | tRNA N6-adenosine threonylcarbamoyltransferase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=tsaD PE=3 SV=1 | 21 | 251 | 6.0E-18 |
sp|Q47LN7|TSAD_THEFY | tRNA N6-adenosine threonylcarbamoyltransferase OS=Thermobifida fusca (strain YX) GN=tsaD PE=3 SV=1 | 11 | 232 | 6.0E-18 |
sp|Q8G4D1|TSAD_BIFLO | tRNA N6-adenosine threonylcarbamoyltransferase OS=Bifidobacterium longum (strain NCC 2705) GN=tsaD PE=3 SV=1 | 12 | 246 | 6.0E-18 |
sp|Q8A997|TSAD_BACTN | tRNA N6-adenosine threonylcarbamoyltransferase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=tsaD PE=3 SV=1 | 1 | 236 | 6.0E-18 |
sp|A6VU47|TSAD_MARMS | tRNA N6-adenosine threonylcarbamoyltransferase OS=Marinomonas sp. (strain MWYL1) GN=tsaD PE=3 SV=1 | 5 | 244 | 6.0E-18 |
sp|Q2J9L8|TSAD_FRASC | tRNA N6-adenosine threonylcarbamoyltransferase OS=Frankia sp. (strain CcI3) GN=tsaD PE=3 SV=1 | 22 | 241 | 6.0E-18 |
sp|Q2YUG0|TSAD_STAAB | tRNA N6-adenosine threonylcarbamoyltransferase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=tsaD PE=3 SV=1 | 1 | 239 | 6.0E-18 |
sp|Q92JK6|TSAD_RICCN | tRNA N6-adenosine threonylcarbamoyltransferase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=tsaD PE=3 SV=1 | 9 | 244 | 6.0E-18 |
sp|Q0I865|TSAD_SYNS3 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Synechococcus sp. (strain CC9311) GN=tsaD PE=3 SV=1 | 9 | 242 | 6.0E-18 |
sp|Q393P6|TSAD_BURL3 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=tsaD PE=3 SV=1 | 9 | 234 | 7.0E-18 |
sp|Q3ALX3|TSAD_SYNSC | tRNA N6-adenosine threonylcarbamoyltransferase OS=Synechococcus sp. (strain CC9605) GN=tsaD PE=3 SV=1 | 5 | 244 | 7.0E-18 |
sp|Q5WU89|TSAD_LEGPL | tRNA N6-adenosine threonylcarbamoyltransferase OS=Legionella pneumophila (strain Lens) GN=tsaD PE=3 SV=1 | 12 | 239 | 8.0E-18 |
sp|A2C0S7|TSAD_PROM1 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Prochlorococcus marinus (strain NATL1A) GN=tsaD PE=3 SV=1 | 9 | 234 | 8.0E-18 |
sp|A0AYZ2|TSAD_BURCH | tRNA N6-adenosine threonylcarbamoyltransferase OS=Burkholderia cenocepacia (strain HI2424) GN=tsaD PE=3 SV=1 | 9 | 234 | 8.0E-18 |
sp|B1K3S7|TSAD_BURCC | tRNA N6-adenosine threonylcarbamoyltransferase OS=Burkholderia cenocepacia (strain MC0-3) GN=tsaD PE=3 SV=1 | 9 | 234 | 8.0E-18 |
sp|Q1BLY9|TSAD_BURCA | tRNA N6-adenosine threonylcarbamoyltransferase OS=Burkholderia cenocepacia (strain AU 1054) GN=tsaD PE=3 SV=1 | 9 | 234 | 8.0E-18 |
sp|Q0BAL6|TSAD_BURCM | tRNA N6-adenosine threonylcarbamoyltransferase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=tsaD PE=3 SV=1 | 9 | 234 | 9.0E-18 |
sp|Q0C5X3|TSAD_HYPNA | tRNA N6-adenosine threonylcarbamoyltransferase OS=Hyphomonas neptunium (strain ATCC 15444) GN=tsaD PE=3 SV=1 | 13 | 232 | 9.0E-18 |
sp|B9KRE8|TSAD_RHOSK | tRNA N6-adenosine threonylcarbamoyltransferase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=tsaD PE=3 SV=1 | 12 | 241 | 1.0E-17 |
sp|Q46GV3|TSAD_PROMT | tRNA N6-adenosine threonylcarbamoyltransferase OS=Prochlorococcus marinus (strain NATL2A) GN=tsaD PE=3 SV=1 | 9 | 247 | 1.0E-17 |
sp|A3DJ13|TSAD_CLOTH | tRNA N6-adenosine threonylcarbamoyltransferase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=tsaD PE=3 SV=1 | 1 | 239 | 1.0E-17 |
sp|A8F0E3|TSAD_RICM5 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Rickettsia massiliae (strain Mtu5) GN=tsaD PE=3 SV=1 | 9 | 244 | 1.0E-17 |
sp|Q9KFD3|TSAD_BACHD | tRNA N6-adenosine threonylcarbamoyltransferase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=tsaD PE=3 SV=1 | 1 | 237 | 1.0E-17 |
sp|Q1MAQ8|TSAD_RHIL3 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=tsaD PE=3 SV=1 | 21 | 251 | 1.0E-17 |
sp|A5IUJ5|TSAD_STAA9 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Staphylococcus aureus (strain JH9) GN=tsaD PE=3 SV=1 | 1 | 239 | 1.0E-17 |
sp|A6U3D4|TSAD_STAA2 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Staphylococcus aureus (strain JH1) GN=tsaD PE=3 SV=1 | 1 | 239 | 1.0E-17 |
sp|B3R5H2|TSAD_CUPTR | tRNA N6-adenosine threonylcarbamoyltransferase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=tsaD PE=3 SV=1 | 2 | 232 | 1.0E-17 |
sp|B1X058|TSAD_CYAA5 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Cyanothece sp. (strain ATCC 51142) GN=tsaD PE=3 SV=1 | 10 | 239 | 1.0E-17 |
sp|B1MG63|TSAD_MYCA9 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=tsaD PE=3 SV=1 | 2 | 229 | 1.0E-17 |
sp|C3PM69|TSAD_RICAE | tRNA N6-adenosine threonylcarbamoyltransferase OS=Rickettsia africae (strain ESF-5) GN=tsaD PE=3 SV=1 | 9 | 244 | 2.0E-17 |
sp|Q3JF13|TSAD_NITOC | tRNA N6-adenosine threonylcarbamoyltransferase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=tsaD PE=3 SV=1 | 1 | 242 | 2.0E-17 |
sp|B2V910|TSAD_SULSY | tRNA N6-adenosine threonylcarbamoyltransferase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=tsaD PE=3 SV=1 | 5 | 256 | 2.0E-17 |
sp|A1B3J6|TSAD_PARDP | tRNA N6-adenosine threonylcarbamoyltransferase OS=Paracoccus denitrificans (strain Pd 1222) GN=tsaD PE=3 SV=1 | 12 | 241 | 2.0E-17 |
sp|Q7MU42|TSAD_PORGI | tRNA N6-adenosine threonylcarbamoyltransferase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=tsaD PE=3 SV=1 | 12 | 248 | 2.0E-17 |
sp|Q5NIC9|TSAD_FRATT | tRNA N6-adenosine threonylcarbamoyltransferase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=tsaD PE=3 SV=1 | 9 | 241 | 2.0E-17 |
sp|B2SFD9|TSAD_FRATM | tRNA N6-adenosine threonylcarbamoyltransferase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=tsaD PE=3 SV=1 | 9 | 241 | 2.0E-17 |
sp|Q14JT2|TSAD_FRAT1 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=tsaD PE=3 SV=1 | 9 | 241 | 2.0E-17 |
sp|A4IWA2|TSAD_FRATW | tRNA N6-adenosine threonylcarbamoyltransferase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=tsaD PE=3 SV=1 | 9 | 241 | 2.0E-17 |
sp|Q7VDB5|TSAD_PROMA | tRNA N6-adenosine threonylcarbamoyltransferase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=tsaD PE=3 SV=1 | 9 | 263 | 2.0E-17 |
sp|Q8DXT9|TSAD_STRA5 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=tsaD PE=3 SV=1 | 22 | 237 | 2.0E-17 |
sp|Q3A3G6|TSAD_PELCD | tRNA N6-adenosine threonylcarbamoyltransferase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=tsaD PE=3 SV=1 | 1 | 232 | 2.0E-17 |
sp|Q7A4H8|TSAD_STAAN | tRNA N6-adenosine threonylcarbamoyltransferase OS=Staphylococcus aureus (strain N315) GN=tsaD PE=1 SV=1 | 1 | 239 | 2.0E-17 |
sp|Q99SK3|TSAD_STAAM | tRNA N6-adenosine threonylcarbamoyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=tsaD PE=3 SV=1 | 1 | 239 | 2.0E-17 |
sp|A7X4L9|TSAD_STAA1 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=tsaD PE=3 SV=1 | 1 | 239 | 2.0E-17 |
sp|A6L5E2|TSAD_BACV8 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=tsaD PE=3 SV=1 | 1 | 236 | 2.0E-17 |
sp|Q3JZC7|TSAD_STRA1 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=tsaD PE=3 SV=1 | 22 | 237 | 3.0E-17 |
sp|A1WHJ5|TSAD_VEREI | tRNA N6-adenosine threonylcarbamoyltransferase OS=Verminephrobacter eiseniae (strain EF01-2) GN=tsaD PE=3 SV=2 | 21 | 262 | 3.0E-17 |
sp|A4XM18|TSAD_CALS8 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=tsaD PE=3 SV=1 | 12 | 242 | 3.0E-17 |
sp|B8EJI6|TSAD_METSB | tRNA N6-adenosine threonylcarbamoyltransferase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=tsaD PE=3 SV=1 | 12 | 233 | 3.0E-17 |
sp|Q8Z0I6|TSAD_NOSS1 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=tsaD PE=3 SV=1 | 10 | 244 | 3.0E-17 |
sp|C0MER2|TSAD_STRS7 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=tsaD PE=3 SV=1 | 22 | 239 | 3.0E-17 |
sp|C0M9J5|TSAD_STRE4 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Streptococcus equi subsp. equi (strain 4047) GN=tsaD PE=3 SV=1 | 22 | 239 | 3.0E-17 |
sp|Q474C0|TSAD_CUPPJ | tRNA N6-adenosine threonylcarbamoyltransferase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=tsaD PE=3 SV=1 | 2 | 232 | 3.0E-17 |
sp|A1IQ95|TSAD_NEIMA | tRNA N6-adenosine threonylcarbamoyltransferase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=tsaD PE=3 SV=1 | 1 | 239 | 3.0E-17 |
sp|A1VM52|TSAD_POLNA | tRNA N6-adenosine threonylcarbamoyltransferase OS=Polaromonas naphthalenivorans (strain CJ2) GN=tsaD PE=3 SV=1 | 2 | 239 | 3.0E-17 |
sp|Q30BK9|TSAD_NEIME | tRNA N6-adenosine threonylcarbamoyltransferase OS=Neisseria meningitidis GN=tsaD PE=3 SV=1 | 1 | 239 | 4.0E-17 |
sp|Q64TJ9|TSAD_BACFR | tRNA N6-adenosine threonylcarbamoyltransferase OS=Bacteroides fragilis (strain YCH46) GN=tsaD PE=3 SV=1 | 1 | 237 | 4.0E-17 |
sp|Q5LCF3|TSAD_BACFN | tRNA N6-adenosine threonylcarbamoyltransferase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=tsaD PE=3 SV=1 | 1 | 237 | 4.0E-17 |
sp|A9FDL0|TSAD_SORC5 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Sorangium cellulosum (strain So ce56) GN=tsaD PE=3 SV=1 | 11 | 249 | 4.0E-17 |
sp|A1KAI4|TSAD_AZOSB | tRNA N6-adenosine threonylcarbamoyltransferase OS=Azoarcus sp. (strain BH72) GN=tsaD PE=3 SV=1 | 2 | 241 | 4.0E-17 |
sp|Q97KL6|TSAD_CLOAB | tRNA N6-adenosine threonylcarbamoyltransferase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=tsaD PE=3 SV=1 | 12 | 244 | 4.0E-17 |
sp|B1I843|TSAD_STRPI | tRNA N6-adenosine threonylcarbamoyltransferase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=tsaD PE=3 SV=1 | 1 | 233 | 5.0E-17 |
sp|B2IRL3|TSAD_STRPS | tRNA N6-adenosine threonylcarbamoyltransferase OS=Streptococcus pneumoniae (strain CGSP14) GN=tsaD PE=3 SV=1 | 1 | 233 | 6.0E-17 |
sp|Q2K3D7|TSAD_RHIEC | tRNA N6-adenosine threonylcarbamoyltransferase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=tsaD PE=3 SV=2 | 21 | 251 | 6.0E-17 |
sp|Q5L3F6|TSAD_GEOKA | tRNA N6-adenosine threonylcarbamoyltransferase OS=Geobacillus kaustophilus (strain HTA426) GN=tsaD PE=3 SV=1 | 1 | 244 | 6.0E-17 |
sp|Q11TP2|TSAD_CYTH3 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=tsaD PE=3 SV=1 | 1 | 232 | 6.0E-17 |
sp|B7K765|TSAD_CYAP7 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Cyanothece sp. (strain PCC 7424) GN=tsaD PE=3 SV=1 | 1 | 244 | 7.0E-17 |
sp|C1CP14|TSAD_STRZT | tRNA N6-adenosine threonylcarbamoyltransferase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=tsaD PE=3 SV=1 | 1 | 233 | 7.0E-17 |
sp|Q8CNL9|TSAD_STAES | tRNA N6-adenosine threonylcarbamoyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=tsaD PE=3 SV=1 | 1 | 244 | 8.0E-17 |
sp|Q5HMG7|TSAD_STAEQ | tRNA N6-adenosine threonylcarbamoyltransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=tsaD PE=3 SV=1 | 1 | 244 | 8.0E-17 |
sp|C0R3B8|TSAD_WOLWR | tRNA N6-adenosine threonylcarbamoyltransferase OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=tsaD PE=3 SV=1 | 12 | 244 | 8.0E-17 |
sp|Q058D1|TSAD_BUCCC | tRNA N6-adenosine threonylcarbamoyltransferase OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=tsaD PE=3 SV=1 | 6 | 239 | 8.0E-17 |
sp|B5YKX4|TSAD_THEYD | tRNA N6-adenosine threonylcarbamoyltransferase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=tsaD PE=3 SV=1 | 12 | 244 | 8.0E-17 |
sp|Q0K862|TSAD_CUPNH | tRNA N6-adenosine threonylcarbamoyltransferase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=tsaD PE=3 SV=1 | 2 | 232 | 8.0E-17 |
sp|C1CAF6|TSAD_STRP7 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Streptococcus pneumoniae (strain 70585) GN=tsaD PE=3 SV=1 | 1 | 233 | 9.0E-17 |
sp|A5CVM3|TSAD_VESOH | tRNA N6-adenosine threonylcarbamoyltransferase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=tsaD PE=3 SV=1 | 2 | 256 | 9.0E-17 |
sp|C1CBV0|TSAD_STRZJ | tRNA N6-adenosine threonylcarbamoyltransferase OS=Streptococcus pneumoniae (strain JJA) GN=tsaD PE=3 SV=1 | 1 | 233 | 9.0E-17 |
sp|A4G2A7|TSAD_HERAR | tRNA N6-adenosine threonylcarbamoyltransferase OS=Herminiimonas arsenicoxydans GN=tsaD PE=3 SV=1 | 2 | 232 | 9.0E-17 |
sp|B8ZK13|TSAD_STRPJ | tRNA N6-adenosine threonylcarbamoyltransferase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=tsaD PE=3 SV=1 | 1 | 233 | 1.0E-16 |
sp|B4RQ33|TSAD_NEIG2 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=tsaD PE=3 SV=1 | 1 | 239 | 1.0E-16 |
sp|Q5FAC2|TSAD_NEIG1 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=tsaD PE=3 SV=1 | 1 | 239 | 1.0E-16 |
sp|A1W9P4|TSAD_ACISJ | tRNA N6-adenosine threonylcarbamoyltransferase OS=Acidovorax sp. (strain JS42) GN=tsaD PE=3 SV=2 | 2 | 243 | 1.0E-16 |
sp|Q1GCQ5|TSAD_RUEST | tRNA N6-adenosine threonylcarbamoyltransferase OS=Ruegeria sp. (strain TM1040) GN=tsaD PE=3 SV=1 | 22 | 241 | 1.0E-16 |
sp|B0JJJ4|TSAD_MICAN | tRNA N6-adenosine threonylcarbamoyltransferase OS=Microcystis aeruginosa (strain NIES-843) GN=tsaD PE=3 SV=1 | 10 | 254 | 1.0E-16 |
sp|A7NEB6|TSAD_FRATF | tRNA N6-adenosine threonylcarbamoyltransferase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=tsaD PE=3 SV=1 | 9 | 241 | 1.0E-16 |
sp|Q98EI6|TSAD_RHILO | tRNA N6-adenosine threonylcarbamoyltransferase OS=Rhizobium loti (strain MAFF303099) GN=tsaD PE=3 SV=1 | 21 | 239 | 1.0E-16 |
sp|B9KXJ0|TSAD_THERP | tRNA N6-adenosine threonylcarbamoyltransferase OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=tsaD PE=3 SV=1 | 12 | 244 | 1.0E-16 |
sp|Q2VYV2|TSAD_MAGSA | tRNA N6-adenosine threonylcarbamoyltransferase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=tsaD PE=3 SV=1 | 10 | 239 | 1.0E-16 |
sp|A7GIP8|TSAD_CLOBL | tRNA N6-adenosine threonylcarbamoyltransferase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=tsaD PE=3 SV=1 | 12 | 244 | 1.0E-16 |
sp|A5I738|TSAD_CLOBH | tRNA N6-adenosine threonylcarbamoyltransferase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=tsaD PE=3 SV=1 | 12 | 244 | 1.0E-16 |
sp|A7FYQ8|TSAD_CLOB1 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=tsaD PE=3 SV=1 | 12 | 244 | 1.0E-16 |
sp|Q127W3|TSAD_POLSJ | tRNA N6-adenosine threonylcarbamoyltransferase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=tsaD PE=3 SV=1 | 21 | 262 | 1.0E-16 |
sp|Q38YS5|TSAD_LACSS | tRNA N6-adenosine threonylcarbamoyltransferase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=tsaD PE=3 SV=1 | 1 | 236 | 2.0E-16 |
sp|Q8E3F9|TSAD_STRA3 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=tsaD PE=3 SV=1 | 22 | 237 | 2.0E-16 |
sp|Q2RGJ3|TSAD_MOOTA | tRNA N6-adenosine threonylcarbamoyltransferase OS=Moorella thermoacetica (strain ATCC 39073) GN=tsaD PE=3 SV=1 | 1 | 228 | 2.0E-16 |
sp|Q97T27|TSAD_STRPN | tRNA N6-adenosine threonylcarbamoyltransferase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=tsaD PE=3 SV=1 | 1 | 233 | 2.0E-16 |
sp|A4WWN6|TSAD_RHOS5 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=tsaD PE=3 SV=1 | 12 | 241 | 2.0E-16 |
sp|Q8DVT0|TSAD_STRMU | tRNA N6-adenosine threonylcarbamoyltransferase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=tsaD PE=3 SV=1 | 22 | 239 | 2.0E-16 |
sp|A8AUT2|TSAD_STRGC | tRNA N6-adenosine threonylcarbamoyltransferase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=tsaD PE=3 SV=1 | 1 | 233 | 2.0E-16 |
sp|Q9F0V0|TSAD_RIEAN | tRNA N6-adenosine threonylcarbamoyltransferase OS=Riemerella anatipestifer GN=tsaD PE=3 SV=1 | 12 | 239 | 2.0E-16 |
sp|C1CI40|TSAD_STRZP | tRNA N6-adenosine threonylcarbamoyltransferase OS=Streptococcus pneumoniae (strain P1031) GN=tsaD PE=3 SV=1 | 1 | 233 | 2.0E-16 |
sp|B9DML1|TSAD_STACT | tRNA N6-adenosine threonylcarbamoyltransferase OS=Staphylococcus carnosus (strain TM300) GN=tsaD PE=3 SV=1 | 1 | 244 | 2.0E-16 |
sp|B1XJF0|TSAD_SYNP2 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=tsaD PE=3 SV=1 | 13 | 244 | 3.0E-16 |
sp|Q2LSP8|TSAD_SYNAS | tRNA N6-adenosine threonylcarbamoyltransferase OS=Syntrophus aciditrophicus (strain SB) GN=tsaD PE=3 SV=1 | 1 | 244 | 3.0E-16 |
sp|Q6NJ39|TSAD_CORDI | tRNA N6-adenosine threonylcarbamoyltransferase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=tsaD PE=3 SV=1 | 19 | 241 | 3.0E-16 |
sp|B1L1Z3|TSAD_CLOBM | tRNA N6-adenosine threonylcarbamoyltransferase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=tsaD PE=3 SV=1 | 12 | 244 | 3.0E-16 |
sp|A1TP41|TSAD_ACIAC | tRNA N6-adenosine threonylcarbamoyltransferase OS=Acidovorax citrulli (strain AAC00-1) GN=tsaD PE=3 SV=1 | 2 | 243 | 3.0E-16 |
sp|B1IFE9|TSAD_CLOBK | tRNA N6-adenosine threonylcarbamoyltransferase OS=Clostridium botulinum (strain Okra / Type B1) GN=tsaD PE=3 SV=1 | 12 | 244 | 3.0E-16 |
sp|Q0BKC8|TSAD_FRATO | tRNA N6-adenosine threonylcarbamoyltransferase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=tsaD PE=3 SV=1 | 9 | 241 | 3.0E-16 |
sp|Q2A1N0|TSAD_FRATH | tRNA N6-adenosine threonylcarbamoyltransferase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=tsaD PE=3 SV=1 | 9 | 241 | 3.0E-16 |
sp|B5E614|TSAD_STRP4 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=tsaD PE=3 SV=1 | 1 | 233 | 3.0E-16 |
sp|B4U0X7|TSAD_STREM | tRNA N6-adenosine threonylcarbamoyltransferase OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=tsaD PE=3 SV=1 | 22 | 239 | 4.0E-16 |
sp|C3KUS7|TSAD_CLOB6 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=tsaD PE=3 SV=1 | 12 | 244 | 4.0E-16 |
sp|Q0AJ91|TSAD_NITEC | tRNA N6-adenosine threonylcarbamoyltransferase OS=Nitrosomonas eutropha (strain C91) GN=tsaD PE=3 SV=1 | 2 | 243 | 4.0E-16 |
sp|Q5Z1G2|TSAD_NOCFA | tRNA N6-adenosine threonylcarbamoyltransferase OS=Nocardia farcinica (strain IFM 10152) GN=tsaD PE=3 SV=1 | 19 | 244 | 4.0E-16 |
sp|Q8DRH2|TSAD_STRR6 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=tsaD PE=3 SV=1 | 1 | 233 | 4.0E-16 |
sp|Q04MU2|TSAD_STRP2 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=tsaD PE=3 SV=1 | 1 | 233 | 4.0E-16 |
sp|B3PND6|TSAD_MYCA5 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Mycoplasma arthritidis (strain 158L3-1) GN=tsaD PE=3 SV=1 | 10 | 237 | 5.0E-16 |
sp|P74034|TSAD_SYNY3 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=tsaD PE=3 SV=1 | 10 | 244 | 5.0E-16 |
sp|Q2VNJ2|TSAD_METAI | tRNA N6-adenosine threonylcarbamoyltransferase OS=Methylocapsa acidiphila GN=tsaD PE=3 SV=1 | 12 | 244 | 5.0E-16 |
sp|Q7V660|TSAD_PROMM | tRNA N6-adenosine threonylcarbamoyltransferase OS=Prochlorococcus marinus (strain MIT 9313) GN=tsaD PE=3 SV=1 | 9 | 239 | 5.0E-16 |
sp|Q5LLR7|TSAD_RUEPO | tRNA N6-adenosine threonylcarbamoyltransferase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=tsaD PE=3 SV=1 | 12 | 241 | 5.0E-16 |
sp|B2J588|TSAD_NOSP7 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=tsaD PE=3 SV=1 | 10 | 244 | 5.0E-16 |
sp|B9MKR8|TSAD_CALBD | tRNA N6-adenosine threonylcarbamoyltransferase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=tsaD PE=3 SV=1 | 16 | 239 | 5.0E-16 |
sp|O86793|TSAD_STRCO | tRNA N6-adenosine threonylcarbamoyltransferase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=tsaD PE=3 SV=1 | 2 | 232 | 6.0E-16 |
sp|Q5FPS6|TSAD_GLUOX | tRNA N6-adenosine threonylcarbamoyltransferase OS=Gluconobacter oxydans (strain 621H) GN=tsaD PE=3 SV=2 | 12 | 243 | 6.0E-16 |
sp|Q9JY06|TSAD_NEIMB | tRNA N6-adenosine threonylcarbamoyltransferase OS=Neisseria meningitidis serogroup B (strain MC58) GN=tsaD PE=3 SV=1 | 1 | 239 | 6.0E-16 |
sp|B3CLX6|TSAD_WOLPP | tRNA N6-adenosine threonylcarbamoyltransferase OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=tsaD PE=3 SV=1 | 12 | 233 | 7.0E-16 |
sp|A2C7G2|TSAD_PROM3 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Prochlorococcus marinus (strain MIT 9303) GN=tsaD PE=3 SV=1 | 9 | 239 | 7.0E-16 |
sp|Q6PEB4|OSGP2_MOUSE | Probable tRNA N6-adenosine threonylcarbamoyltransferase, mitochondrial OS=Mus musculus GN=Osgepl1 PE=1 SV=2 | 19 | 239 | 7.0E-16 |
sp|C5CD32|TSAD_KOSOT | tRNA N6-adenosine threonylcarbamoyltransferase OS=Kosmotoga olearia (strain TBF 19.5.1) GN=tsaD PE=3 SV=1 | 12 | 244 | 7.0E-16 |
sp|A1ARX8|TSAD_PELPD | tRNA N6-adenosine threonylcarbamoyltransferase OS=Pelobacter propionicus (strain DSM 2379) GN=tsaD PE=3 SV=1 | 11 | 232 | 7.0E-16 |
sp|A5CE49|TSAD_ORITB | tRNA N6-adenosine threonylcarbamoyltransferase OS=Orientia tsutsugamushi (strain Boryong) GN=tsaD PE=3 SV=1 | 9 | 233 | 8.0E-16 |
sp|A1SMX2|TSAD_NOCSJ | tRNA N6-adenosine threonylcarbamoyltransferase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=tsaD PE=3 SV=1 | 2 | 245 | 9.0E-16 |
sp|B3PQA4|TSAD_RHIE6 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Rhizobium etli (strain CIAT 652) GN=tsaD PE=3 SV=1 | 21 | 251 | 9.0E-16 |
sp|Q8UC47|TSAD_AGRFC | tRNA N6-adenosine threonylcarbamoyltransferase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=tsaD PE=3 SV=2 | 13 | 233 | 9.0E-16 |
sp|A9IZF6|TSAD_BART1 | tRNA N6-adenosine threonylcarbamoyltransferase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=tsaD PE=3 SV=1 | 10 | 248 | 1.0E-15 |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
Yes | 1 - 17 | 0.45 |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >Hirsu2|5211 MGAPLTAVAVAARVLALLWSKPLVGVNHCVGHIEMGRDVTGARDPVVLYVSGGNSQVIAYAERRYRILGETLDIA VGNCLDRFARTLAISNDPAPGYNIEQLARRAAARASPPRLLDLPYAVKGMDCSFSGILAAADALAARLRDDGPAA AGYDAADLCYALQETVFAMLVEITERAMAHVGASHVLVVGGVGCNLRLQAMMADMARARGGAVHATDDRFCIDNG LMIAHAGLLAFRTGARTPLPDSRCVQRFRTDDVCVAWRR* |
Coding | >Hirsu2|5211 ATGGGCGCGCCGCTGACGGCCGTCGCCGTCGCCGCGCGCGTGCTGGCCCTGCTGTGGTCCAAGCCGCTCGTCGGC GTCAACCACTGCGTCGGCCACATCGAGATGGGCCGCGACGTGACGGGCGCCCGCGACCCCGTCGTCCTCTACGTC AGCGGCGGCAACTCGCAGGTCATCGCCTACGCCGAGCGCCGCTACCGCATCCTCGGCGAGACGCTCGACATCGCC GTCGGCAACTGCCTCGACCGCTTCGCCCGCACCCTCGCCATCAGCAACGACCCGGCCCCCGGCTACAACATCGAG CAGCTGGCCCGCCGCGCCGCCGCCCGCGCCTCCCCCCCGCGCCTGCTCGACCTGCCCTACGCCGTCAAGGGCATG GACTGCTCCTTCAGCGGCATTCTGGCCGCCGCCGACGCCCTGGCCGCCCGCCTCCGCGACGACGGCCCCGCCGCC GCCGGCTACGACGCCGCCGACCTTTGCTACGCCCTGCAGGAGACCGTCTTCGCCATGCTGGTCGAGATCACCGAG CGCGCCATGGCCCACGTCGGCGCCTCCCACGTCCTCGTCGTCGGCGGTGTCGGCTGCAACCTCCGCCTGCAGGCC ATGATGGCCGACATGGCCCGCGCCCGCGGCGGCGCCGTCCACGCCACCGACGACCGCTTCTGCATCGACAACGGC CTCATGATCGCCCACGCCGGCCTGCTCGCCTTCCGCACCGGCGCCCGCACCCCGCTGCCCGACAGCCGCTGCGTC CAGCGCTTCCGCACCGACGACGTCTGCGTCGCCTGGCGCCGTTGA |
Transcript | >Hirsu2|5211 ATGGGCGCGCCGCTGACGGCCGTCGCCGTCGCCGCGCGCGTGCTGGCCCTGCTGTGGTCCAAGCCGCTCGTCGGC GTCAACCACTGCGTCGGCCACATCGAGATGGGCCGCGACGTGACGGGCGCCCGCGACCCCGTCGTCCTCTACGTC AGCGGCGGCAACTCGCAGGTCATCGCCTACGCCGAGCGCCGCTACCGCATCCTCGGCGAGACGCTCGACATCGCC GTCGGCAACTGCCTCGACCGCTTCGCCCGCACCCTCGCCATCAGCAACGACCCGGCCCCCGGCTACAACATCGAG CAGCTGGCCCGCCGCGCCGCCGCCCGCGCCTCCCCCCCGCGCCTGCTCGACCTGCCCTACGCCGTCAAGGGCATG GACTGCTCCTTCAGCGGCATTCTGGCCGCCGCCGACGCCCTGGCCGCCCGCCTCCGCGACGACGGCCCCGCCGCC GCCGGCTACGACGCCGCCGACCTTTGCTACGCCCTGCAGGAGACCGTCTTCGCCATGCTGGTCGAGATCACCGAG CGCGCCATGGCCCACGTCGGCGCCTCCCACGTCCTCGTCGTCGGCGGTGTCGGCTGCAACCTCCGCCTGCAGGCC ATGATGGCCGACATGGCCCGCGCCCGCGGCGGCGCCGTCCACGCCACCGACGACCGCTTCTGCATCGACAACGGC CTCATGATCGCCCACGCCGGCCTGCTCGCCTTCCGCACCGGCGCCCGCACCCCGCTGCCCGACAGCCGCTGCGTC CAGCGCTTCCGCACCGACGACGTCTGCGTCGCCTGGCGCCGTTGA |
Gene | >Hirsu2|5211 ATGGGCGCGCCGCTGACGGCCGTCGCCGTCGCCGCGCGCGTGCTGGCCCTGCTGTGGTCCAAGCCGCTCGTCGGC GTCAACCACTGCGTCGGCCACATCGAGATGGGCCGCGACGTGACGGGCGCCCGCGACCCCGTCGTCCTCTACGTC AGCGGCGGCAACTCGCAGGTCATCGCCTACGCCGAGCGCCGCTACCGCATCCTCGGCGAGACGCTCGACATCGCC GTCGGCAACTGCCTCGACCGCTTCGCCCGCACCCTCGCCATCAGCAACGACCCGGCCCCCGGCTACAACATCGAG CAGCTGGCCCGCCGCGCCGCCGCCCGCGCCTCCCCCCCGCGCCTGCTCGACCTGCCCTACGCCGTCAAGGGCATG GACTGCTCCTTCAGCGGCATTCTGGCCGCCGCCGACGCCCTGGCCGCCCGCCTCCGCGACGACGGCCCCGCCGCC GCCGGCTACGACGCCGCCGACCTTTGCTACGCCCTGCAGGAGACCGTCTTCGCCATGCTGGTCGAGATCACCGAG CGCGCCATGGCCCACGTCGGCGCCTCCCACGTCCTCGTCGTCGGCGGTGTCGGCTGCAACCTCCGCCTGCAGGCC ATGATGGCCGACATGGCCCGCGCCCGCGGCGGCGCCGTCCACGCCACCGACGACCGCTTCTGCATCGACAACGGC CTCATGATCGCCCACGCCGGCCTGCTCGCCTTCCGCACCGGCGCCCGCACCCCGCTGCCCGACAGCCGCTGCGTC CAGCGCTTCCGCACCGACGACGTCTGCGTCGCCTGGCGCCGTTGA |