Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5204
Gene name
LocationContig_26:52182..52605
Strand+
Gene length (bp)423
Transcript length (bp)288
Coding sequence length (bp)288
Protein length (aa) 96

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03297 Ribosomal_S25 S25 ribosomal protein 1.8E-37 4 91

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SC06|RS25_NEUCR 40S ribosomal protein S25 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rps-25 PE=3 SV=1 1 93 7.0E-39
sp|O74172|RS25B_SCHPO 40S ribosomal protein S25-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps2501 PE=3 SV=1 21 95 4.0E-21
sp|P79009|RS25A_SCHPO 40S ribosomal protein S25-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps2502 PE=3 SV=2 21 95 2.0E-20
sp|P48588|RS25_DROME 40S ribosomal protein S25 OS=Drosophila melanogaster GN=RpS25 PE=1 SV=3 17 94 2.0E-20
sp|Q962Q5|RS25_SPOFR 40S ribosomal protein S25 OS=Spodoptera frugiperda GN=RpS25 PE=3 SV=1 17 94 3.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SC06|RS25_NEUCR 40S ribosomal protein S25 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rps-25 PE=3 SV=1 1 93 7.0E-39
sp|O74172|RS25B_SCHPO 40S ribosomal protein S25-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps2501 PE=3 SV=1 21 95 4.0E-21
sp|P79009|RS25A_SCHPO 40S ribosomal protein S25-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps2502 PE=3 SV=2 21 95 2.0E-20
sp|P48588|RS25_DROME 40S ribosomal protein S25 OS=Drosophila melanogaster GN=RpS25 PE=1 SV=3 17 94 2.0E-20
sp|Q962Q5|RS25_SPOFR 40S ribosomal protein S25 OS=Spodoptera frugiperda GN=RpS25 PE=3 SV=1 17 94 3.0E-20
sp|Q3E792|RS25A_YEAST 40S ribosomal protein S25-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS25A PE=1 SV=1 21 94 1.0E-19
sp|P0C0T4|RS25B_YEAST 40S ribosomal protein S25-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS25B PE=1 SV=1 21 91 1.0E-19
sp|Q8ISN9|RS25_BRABE 40S ribosomal protein S25 OS=Branchiostoma belcheri GN=RPS25 PE=2 SV=1 17 91 9.0E-19
sp|Q6FPX5|RS25_CANGA 40S ribosomal protein S25 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RPS25 PE=3 SV=1 23 91 4.0E-18
sp|Q75DJ1|RS25_ASHGO 40S ribosomal protein S25 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPS25 PE=3 SV=1 23 94 2.0E-17
sp|Q03409|RS25_DICDI 40S ribosomal protein S25 OS=Dictyostelium discoideum GN=rps25 PE=3 SV=1 11 91 2.0E-17
sp|Q6PBI5|RS25_DANRE 40S ribosomal protein S25 OS=Danio rerio GN=rps25 PE=2 SV=1 17 95 4.0E-17
sp|Q9T029|RS254_ARATH 40S ribosomal protein S25-4 OS=Arabidopsis thaliana GN=RPS25E PE=2 SV=1 21 93 7.0E-17
sp|Q8GYL5|RS253_ARATH 40S ribosomal protein S25-3 OS=Arabidopsis thaliana GN=RPS25D PE=3 SV=2 21 94 1.0E-16
sp|Q9SIK2|RS252_ARATH 40S ribosomal protein S25-2 OS=Arabidopsis thaliana GN=RPS25B PE=2 SV=1 21 93 3.0E-16
sp|Q9SIW5|RS251_ARATH 40S ribosomal protein S25-1 OS=Arabidopsis thaliana GN=RPS25A PE=3 SV=3 21 91 1.0E-15
sp|Q6Q311|RS25_SHEEP 40S ribosomal protein S25 OS=Ovis aries GN=RPS25 PE=2 SV=1 17 94 1.0E-15
sp|P62853|RS25_RAT 40S ribosomal protein S25 OS=Rattus norvegicus GN=Rps25 PE=2 SV=1 17 94 1.0E-15
sp|P62852|RS25_MOUSE 40S ribosomal protein S25 OS=Mus musculus GN=Rps25 PE=1 SV=1 17 94 1.0E-15
sp|P62851|RS25_HUMAN 40S ribosomal protein S25 OS=Homo sapiens GN=RPS25 PE=1 SV=1 17 94 1.0E-15
sp|Q56JX5|RS25_BOVIN 40S ribosomal protein S25 OS=Bos taurus GN=RPS25 PE=2 SV=1 17 94 1.0E-15
sp|Q9N9V4|RS25_LEIIN 40S ribosomal protein S25 OS=Leishmania infantum GN=RPS25 PE=2 SV=1 6 92 2.0E-15
sp|P46301|RS25_SOLLC 40S ribosomal protein S25 OS=Solanum lycopersicum GN=RPS25 PE=3 SV=1 21 93 2.0E-15
sp|P52821|RS25_CAEEL 40S ribosomal protein S25 OS=Caenorhabditis elegans GN=rps-25 PE=3 SV=1 17 91 8.0E-15
sp|Q94G66|RS25_AMACR 40S ribosomal protein S25 OS=Amaranthus cruentus GN=RPS25 PE=3 SV=1 21 93 1.0E-14
sp|Q90YP9|RS25_ICTPU 40S ribosomal protein S25 OS=Ictalurus punctatus GN=rps25 PE=2 SV=1 17 95 6.0E-14
sp|Q8STD9|RS25_ENCCU 40S ribosomal protein S25 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPS25-1 PE=3 SV=1 1 88 4.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 64 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5204
MAPAAGAKKQKKKWSKGKVKDKAQHAVLLDKATSEKLYKDVQSYRLVTIATLVDRMKINGSLARQCIADLEEKGM
IKAVVTHSKMKIYTRAVGGS*
Coding >Hirsu2|5204
ATGGCGCCCGCTGCTGGAGCAAAGAAGCAAAAGAAGAAGTGGTCCAAGGGCAAGGTCAAGGACAAGGCCCAGCAC
GCCGTCCTGCTCGACAAGGCTACTTCGGAGAAGCTCTACAAGGATGTGCAATCGTACCGTCTCGTCACCATCGCC
ACCCTCGTCGACCGAATGAAGATCAACGGCTCGCTGGCTCGGCAGTGCATCGCCGACCTGGAGGAGAAGGGCATG
ATCAAGGCCGTCGTCACTCACAGCAAGATGAAGATCTATACCCGCGCCGTCGGTGGCTCCTAA
Transcript >Hirsu2|5204
ATGGCGCCCGCTGCTGGAGCAAAGAAGCAAAAGAAGAAGTGGTCCAAGGGCAAGGTCAAGGACAAGGCCCAGCAC
GCCGTCCTGCTCGACAAGGCTACTTCGGAGAAGCTCTACAAGGATGTGCAATCGTACCGTCTCGTCACCATCGCC
ACCCTCGTCGACCGAATGAAGATCAACGGCTCGCTGGCTCGGCAGTGCATCGCCGACCTGGAGGAGAAGGGCATG
ATCAAGGCCGTCGTCACTCACAGCAAGATGAAGATCTATACCCGCGCCGTCGGTGGCTCCTAA
Gene >Hirsu2|5204
ATGGTACGCCCGCACCAGCCACTCCGCCGATGGCGCCGCGCAGGCAAGACTAACCTGGGGGACGATCTGGACAGG
CGCCCGCTGCTGGAGCAAAGAAGCAAAAGAAGAAGTGGTCCAAGGGCAAGGTCAAGGACAAGGCCCAGCACGCCG
TCCTGCTCGACAAGGCTACTTCGGAGAAGCTCTACAAGGATGTGCAATCGTACCGTCTCGTCACCATCGCCACCC
TCGTCGACCGAATGAAGATCAACGGCTCGCTGGCTCGGCAGTGCATCGCCGACCTGGAGGAGAAGGGCATGATCA
AGGCCGTCGTCACTCACAGCAAGATGAAGATCTATAGTATGCCCGCGAACCCCACCGAGCGCTGAGCAGATGGCA
GAACCTGCGAGCTAACACATGACAGCCCGCGCCGTCGGTGGCTCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail