© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Hirsu2|5191 |
| Gene name | |
| Location | Contig_26:13295..15412 |
| Strand | - |
| Gene length (bp) | 2117 |
| Transcript length (bp) | 1782 |
| Coding sequence length (bp) | 1782 |
| Protein length (aa) | 594 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00067 | p450 | Cytochrome P450 | 3.6E-51 | 118 | 533 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q4WAW5|FTMC_ASPFU | Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-1 PE=3 SV=2 | 7 | 525 | 9.0E-86 |
| sp|B9WZX1|FTMC_ASPFM | Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata GN=ftmP450-1 PE=1 SV=1 | 7 | 525 | 9.0E-86 |
| sp|A1DA60|FTMC_NEOFI | Tryprostatin B 6-hydroxylase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-1 PE=3 SV=1 | 7 | 525 | 3.0E-78 |
| sp|O00061|CP67_UROFA | Cytochrome P450 67 (Fragment) OS=Uromyces fabae GN=CYP67 PE=2 SV=1 | 60 | 525 | 6.0E-48 |
| sp|O13317|TRI11_FUSSP | Isotrichodermin C-15 hydroxylase OS=Fusarium sporotrichioides GN=TRI11 PE=3 SV=1 | 59 | 537 | 3.0E-43 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q4WAW5|FTMC_ASPFU | Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-1 PE=3 SV=2 | 7 | 525 | 9.0E-86 |
| sp|B9WZX1|FTMC_ASPFM | Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata GN=ftmP450-1 PE=1 SV=1 | 7 | 525 | 9.0E-86 |
| sp|A1DA60|FTMC_NEOFI | Tryprostatin B 6-hydroxylase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-1 PE=3 SV=1 | 7 | 525 | 3.0E-78 |
| sp|O00061|CP67_UROFA | Cytochrome P450 67 (Fragment) OS=Uromyces fabae GN=CYP67 PE=2 SV=1 | 60 | 525 | 6.0E-48 |
| sp|O13317|TRI11_FUSSP | Isotrichodermin C-15 hydroxylase OS=Fusarium sporotrichioides GN=TRI11 PE=3 SV=1 | 59 | 537 | 3.0E-43 |
| sp|Q12608|STCB_EMENI | Probable sterigmatocystin biosynthesis P450 monooxygenase STCB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcB PE=3 SV=2 | 87 | 503 | 2.0E-37 |
| sp|Q9UW95|AFLL_ASPPA | Versicolorin B desaturase OS=Aspergillus parasiticus GN=verB PE=3 SV=1 | 82 | 515 | 4.0E-37 |
| sp|Q00707|STCL_EMENI | Versicolorin B desaturase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcL PE=1 SV=2 | 82 | 508 | 1.0E-35 |
| sp|Q12609|STCF_EMENI | Probable sterigmatocystin biosynthesis P450 monooxygenase stcF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcF PE=3 SV=3 | 80 | 508 | 7.0E-35 |
| sp|Q12732|AVNA_ASPPA | Averantin hydroxylase OS=Aspergillus parasiticus GN=avnA PE=1 SV=2 | 80 | 525 | 8.0E-34 |
| sp|Q12645|PID9_FUSSO | Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDAT9 PE=3 SV=1 | 82 | 512 | 4.0E-33 |
| sp|P38364|PID6_FUSSO | Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDA6-1 PE=3 SV=1 | 82 | 512 | 5.0E-30 |
| sp|Q64148|CP3AA_MESAU | Lithocholate 6-beta-hydroxylase OS=Mesocricetus auratus GN=CYP3A10 PE=1 SV=2 | 173 | 537 | 6.0E-26 |
| sp|Q12612|TRI4_FUSSP | Trichodiene oxygenase OS=Fusarium sporotrichioides GN=TRI4 PE=3 SV=1 | 63 | 541 | 2.0E-25 |
| sp|P11707|CP3A6_RABIT | Cytochrome P450 3A6 OS=Oryctolagus cuniculus GN=CYP3A6 PE=2 SV=2 | 184 | 509 | 3.0E-25 |
| sp|P51538|CP3A9_RAT | Cytochrome P450 3A9 OS=Rattus norvegicus GN=Cyp3a9 PE=2 SV=2 | 184 | 507 | 8.0E-25 |
| sp|Q9PVE8|C330_FUNHE | Cytochrome P450 3A30 OS=Fundulus heteroclitus GN=cyp3a30 PE=2 SV=2 | 167 | 506 | 3.0E-24 |
| sp|Q8AXY5|C356_FUNHE | Cytochrome P450 3A56 OS=Fundulus heteroclitus GN=cyp3a56 PE=2 SV=1 | 167 | 506 | 4.0E-24 |
| sp|Q64409|CP3AH_CAVPO | Cytochrome P450 3A17 OS=Cavia porcellus GN=CYP3A17 PE=2 SV=1 | 122 | 506 | 8.0E-24 |
| sp|O18993|CP3AL_CALJA | Cytochrome P450 3A21 OS=Callithrix jacchus GN=CYP3A21 PE=2 SV=1 | 184 | 507 | 1.0E-23 |
| sp|Q64464|CP3AD_MOUSE | Cytochrome P450 3A13 OS=Mus musculus GN=Cyp3a13 PE=1 SV=1 | 184 | 504 | 3.0E-23 |
| sp|Q98T91|C340_ORYLA | Cytochrome P450 3A40 OS=Oryzias latipes GN=cyp3a40 PE=2 SV=1 | 167 | 506 | 6.0E-23 |
| sp|P08684|CP3A4_HUMAN | Cytochrome P450 3A4 OS=Homo sapiens GN=CYP3A4 PE=1 SV=4 | 95 | 507 | 6.0E-23 |
| sp|Q64406|CP3AF_CAVPO | Cytochrome P450 3A15 OS=Cavia porcellus GN=CYP3A15 PE=2 SV=1 | 95 | 506 | 7.0E-23 |
| sp|Q64481|CP3AG_MOUSE | Cytochrome P450 3A16 OS=Mus musculus GN=Cyp3a16 PE=2 SV=2 | 184 | 507 | 1.0E-22 |
| sp|Q64417|CP3AE_CAVPO | Cytochrome P450 3A14 OS=Cavia porcellus GN=CYP3A14 PE=2 SV=2 | 95 | 506 | 2.0E-22 |
| sp|P20815|CP3A5_HUMAN | Cytochrome P450 3A5 OS=Homo sapiens GN=CYP3A5 PE=1 SV=1 | 184 | 507 | 3.0E-22 |
| sp|Q64459|CP3AB_MOUSE | Cytochrome P450 3A11 OS=Mus musculus GN=Cyp3a11 PE=1 SV=1 | 170 | 507 | 6.0E-22 |
| sp|P24462|CP3A7_HUMAN | Cytochrome P450 3A7 OS=Homo sapiens GN=CYP3A7 PE=1 SV=2 | 184 | 507 | 7.0E-22 |
| sp|Q29496|CP3AO_SHEEP | Cytochrome P450 3A24 OS=Ovis aries GN=CYP3A24 PE=2 SV=1 | 117 | 507 | 4.0E-21 |
| sp|P79401|CP3AT_PIG | Cytochrome P450 3A29 OS=Sus scrofa GN=CYP3A29 PE=2 SV=1 | 184 | 537 | 5.0E-21 |
| sp|Q9HB55|CP343_HUMAN | Cytochrome P450 3A43 OS=Homo sapiens GN=CYP3A43 PE=1 SV=1 | 184 | 507 | 6.0E-21 |
| sp|O09158|CP3AP_MOUSE | Cytochrome P450 3A25 OS=Mus musculus GN=Cyp3a25 PE=1 SV=1 | 173 | 504 | 8.0E-21 |
| sp|P17549|CP53_ASPNG | Benzoate 4-monooxygenase OS=Aspergillus niger GN=bphA PE=1 SV=1 | 91 | 507 | 1.0E-20 |
| sp|Q9VMS8|C4AC2_DROME | Probable cytochrome P450 4ac2 OS=Drosophila melanogaster GN=Cyp4ac2 PE=2 SV=4 | 162 | 504 | 1.0E-20 |
| sp|P05183|CP3A2_RAT | Cytochrome P450 3A2 OS=Rattus norvegicus GN=Cyp3a2 PE=1 SV=2 | 141 | 507 | 2.0E-20 |
| sp|P04800|CP3A1_RAT | Cytochrome P450 3A1 OS=Rattus norvegicus GN=Cyp3a1 PE=1 SV=1 | 141 | 537 | 2.0E-20 |
| sp|P24463|CP3AC_CANLF | Cytochrome P450 3A12 OS=Canis lupus familiaris GN=CYP3A12 PE=2 SV=1 | 168 | 507 | 2.0E-20 |
| sp|Q64581|CP3AI_RAT | Cytochrome P450 3A18 OS=Rattus norvegicus GN=Cyp3a18 PE=2 SV=1 | 173 | 507 | 3.0E-20 |
| sp|Q9JMA7|CP341_MOUSE | Cytochrome P450 3A41 OS=Mus musculus GN=Cyp3a41a PE=1 SV=2 | 184 | 507 | 1.0E-19 |
| sp|P79102|CP3AS_BOVIN | Cytochrome P450 3A28 OS=Bos taurus GN=CYP3A28 PE=2 SV=1 | 184 | 507 | 1.0E-19 |
| sp|P05177|CP1A2_HUMAN | Cytochrome P450 1A2 OS=Homo sapiens GN=CYP1A2 PE=1 SV=3 | 120 | 511 | 2.0E-19 |
| sp|P33268|CP3A8_MACFA | Cytochrome P450 3A8 OS=Macaca fascicularis GN=CYP3A8 PE=1 SV=1 | 184 | 507 | 3.0E-19 |
| sp|O70537|CP3AV_MESAU | Cytochrome P450 3A31 OS=Mesocricetus auratus GN=CYP3A31 PE=2 SV=1 | 184 | 507 | 4.0E-19 |
| sp|Q9DBG1|CP27A_MOUSE | Sterol 26-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27a1 PE=1 SV=1 | 337 | 520 | 2.0E-18 |
| sp|Q3LFT9|CP1A2_BALAC | Cytochrome P450 1A2 OS=Balaenoptera acutorostrata GN=CYP1A2 PE=2 SV=3 | 120 | 511 | 3.0E-18 |
| sp|O15528|CP27B_HUMAN | 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27B1 PE=1 SV=1 | 274 | 511 | 7.0E-18 |
| sp|Q9VMS7|C4AC3_DROME | Probable cytochrome P450 4ac3 OS=Drosophila melanogaster GN=Cyp4ac3 PE=2 SV=2 | 162 | 504 | 1.0E-17 |
| sp|Q9WVK8|CP46A_MOUSE | Cholesterol 24-hydroxylase OS=Mus musculus GN=Cyp46a1 PE=1 SV=1 | 94 | 512 | 2.0E-17 |
| sp|P11711|CP2A1_RAT | Cytochrome P450 2A1 OS=Rattus norvegicus GN=Cyp2a1 PE=1 SV=2 | 120 | 508 | 4.0E-17 |
| sp|Q9QUJ1|CP2DS_MESAU | Cytochrome P450 2D28 OS=Mesocricetus auratus GN=CYP2D28A PE=2 SV=1 | 194 | 537 | 4.0E-17 |
| sp|P24455|CP2A9_MESAU | Cytochrome P450 2A9 OS=Mesocricetus auratus GN=CYP2A9 PE=2 SV=2 | 95 | 537 | 5.0E-17 |
| sp|P17178|CP27A_RAT | Sterol 26-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27a1 PE=1 SV=1 | 337 | 511 | 6.0E-17 |
| sp|Q6VVX0|CP2R1_HUMAN | Vitamin D 25-hydroxylase OS=Homo sapiens GN=CYP2R1 PE=1 SV=1 | 331 | 508 | 6.0E-17 |
| sp|O77809|CP1A2_MACFA | Cytochrome P450 1A2 OS=Macaca fascicularis GN=CYP1A2 PE=1 SV=3 | 120 | 511 | 8.0E-17 |
| sp|P12938|CP2D3_RAT | Cytochrome P450 2D3 OS=Rattus norvegicus GN=Cyp2d3 PE=2 SV=2 | 194 | 534 | 1.0E-16 |
| sp|P56593|CP2AC_MOUSE | Cytochrome P450 2A12 OS=Mus musculus GN=Cyp2a12 PE=1 SV=2 | 120 | 508 | 1.0E-16 |
| sp|Q29488|CP2DH_MACFA | Cytochrome P450 2D17 OS=Macaca fascicularis GN=CYP2D17 PE=2 SV=1 | 194 | 537 | 2.0E-16 |
| sp|O42563|CP3AR_ONCMY | Cytochrome P450 3A27 OS=Oncorhynchus mykiss GN=cyp3a27 PE=2 SV=1 | 176 | 506 | 2.0E-16 |
| sp|O35132|CP27B_RAT | 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27b1 PE=2 SV=2 | 337 | 511 | 2.0E-16 |
| sp|Q00714|STCS_EMENI | Probable sterigmatocystin biosynthesis P450 monooxygenase stcS OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcS PE=1 SV=2 | 184 | 516 | 2.0E-16 |
| sp|Q1ZXL2|C518B_DICDI | Probable cytochrome P450 518B1 OS=Dictyostelium discoideum GN=cyp518B1 PE=3 SV=1 | 263 | 512 | 3.0E-16 |
| sp|Q9Y6A2|CP46A_HUMAN | Cholesterol 24-hydroxylase OS=Homo sapiens GN=CYP46A1 PE=1 SV=1 | 125 | 512 | 3.0E-16 |
| sp|Q27698|CP6D1_MUSDO | Cytochrome P450 6d1 OS=Musca domestica GN=CYP6D1 PE=1 SV=1 | 196 | 513 | 3.0E-16 |
| sp|P82712|CCD1P_DROME | Probable cytochrome P450 12d1 proximal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-p PE=2 SV=3 | 344 | 508 | 4.0E-16 |
| sp|Q7KR10|CCD1D_DROME | Probable cytochrome P450 12d1 distal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-d PE=2 SV=1 | 344 | 508 | 4.0E-16 |
| sp|Q9QYG6|CP2DR_MESAU | Cytochrome P450 2D27 OS=Mesocricetus auratus GN=CYP2D27 PE=1 SV=1 | 194 | 539 | 4.0E-16 |
| sp|Q9CX98|CP2U1_MOUSE | Cytochrome P450 2U1 OS=Mus musculus GN=Cyp2u1 PE=2 SV=2 | 167 | 541 | 5.0E-16 |
| sp|Q4V8D1|CP2U1_RAT | Cytochrome P450 2U1 OS=Rattus norvegicus GN=Cyp2u1 PE=1 SV=1 | 167 | 534 | 5.0E-16 |
| sp|Q6WKZ0|C7D94_MENGR | Cytochrome P450 71D94 OS=Mentha gracilis GN=CYP71D94 PE=2 SV=1 | 119 | 540 | 5.0E-16 |
| sp|O16805|CP4D1_DROSI | Cytochrome P450 4d1 OS=Drosophila simulans GN=Cyp4d1 PE=3 SV=1 | 67 | 509 | 6.0E-16 |
| sp|Q5KQT6|CP1A2_FELCA | Cytochrome P450 1A2 OS=Felis catus GN=CYP1A2 PE=2 SV=1 | 119 | 511 | 6.0E-16 |
| sp|P33269|CP4D1_DROME | Cytochrome P450 4d1 OS=Drosophila melanogaster GN=Cyp4d1 PE=2 SV=2 | 67 | 509 | 7.0E-16 |
| sp|Q964Q7|CP6D3_MUSDO | Cytochrome P450 6d3 OS=Musca domestica GN=CYP6D3 PE=2 SV=1 | 210 | 521 | 8.0E-16 |
| sp|Q4H4C3|CP1A2_MACFU | Cytochrome P450 1A2 OS=Macaca fuscata fuscata GN=CYP1A2 PE=2 SV=3 | 120 | 511 | 9.0E-16 |
| sp|Q9VGB5|CP135_DROME | Probable cytochrome P450 313a5 OS=Drosophila melanogaster GN=Cyp313a5 PE=1 SV=2 | 182 | 504 | 9.0E-16 |
| sp|Q5RBQ1|CP1A2_PONAB | Cytochrome P450 1A2 OS=Pongo abelii GN=CYP1A2 PE=2 SV=3 | 111 | 511 | 1.0E-15 |
| sp|Q6VVW9|CP2R1_MOUSE | Vitamin D 25-hydroxylase OS=Mus musculus GN=Cyp2r1 PE=2 SV=1 | 331 | 508 | 2.0E-15 |
| sp|Q9QYG5|CP2DK_MESAU | Cytochrome P450 2D20 OS=Mesocricetus auratus GN=CYP2D20 PE=2 SV=1 | 194 | 539 | 2.0E-15 |
| sp|Q7Z449|CP2U1_HUMAN | Cytochrome P450 2U1 OS=Homo sapiens GN=CYP2U1 PE=1 SV=1 | 273 | 534 | 2.0E-15 |
| sp|Q9XHE7|C71DD_MENPI | Cytochrome P450 71D13 OS=Mentha piperita GN=CYP71D13 PE=1 SV=1 | 347 | 517 | 2.0E-15 |
| sp|Q96581|C75A4_GENTR | Flavonoid 3',5'-hydroxylase OS=Gentiana triflora GN=CYP75A4 PE=2 SV=1 | 300 | 517 | 2.0E-15 |
| sp|P13108|CP2D4_RAT | Cytochrome P450 2D4 OS=Rattus norvegicus GN=Cyp2d4 PE=2 SV=2 | 303 | 534 | 2.0E-15 |
| sp|O77810|CP1A2_CALJA | Cytochrome P450 1A2 OS=Callithrix jacchus GN=CYP1A2 PE=2 SV=3 | 120 | 511 | 2.0E-15 |
| sp|Q6IV13|C7D95_MENSP | Cytochrome P450 71D95 OS=Mentha spicata GN=CYP71D95 PE=1 SV=1 | 347 | 542 | 3.0E-15 |
| sp|Q556M4|C5082_DICDI | Probable cytochrome P450 508A2 OS=Dictyostelium discoideum GN=cyp508A2-1 PE=3 SV=1 | 337 | 540 | 3.0E-15 |
| sp|Q556M5|C5081_DICDI | Probable cytochrome P450 508A1 OS=Dictyostelium discoideum GN=cyp508A1-1 PE=3 SV=1 | 337 | 512 | 3.0E-15 |
| sp|P00187|CP1A2_RABIT | Cytochrome P450 1A2 OS=Oryctolagus cuniculus GN=CYP1A2 PE=1 SV=3 | 91 | 511 | 3.0E-15 |
| sp|Q0IIF9|CP2U1_BOVIN | Cytochrome P450 2U1 OS=Bos taurus GN=CYP2U1 PE=2 SV=1 | 274 | 506 | 3.0E-15 |
| sp|O35084|CP27B_MOUSE | 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27b1 PE=2 SV=2 | 274 | 511 | 3.0E-15 |
| sp|O54749|CP2J5_MOUSE | Cytochrome P450 2J5 OS=Mus musculus GN=Cyp2j5 PE=1 SV=1 | 71 | 507 | 3.0E-15 |
| sp|O64638|C76C3_ARATH | Cytochrome P450 76C3 OS=Arabidopsis thaliana GN=CYP76C3 PE=2 SV=2 | 289 | 511 | 3.0E-15 |
| sp|Q9VFP1|CP6D5_DROME | Probable cytochrome P450 6d5 OS=Drosophila melanogaster GN=Cyp6d5 PE=2 SV=1 | 196 | 508 | 3.0E-15 |
| sp|O46051|C4D14_DROME | Probable cytochrome P450 4d14 OS=Drosophila melanogaster GN=Cyp4d14 PE=3 SV=1 | 298 | 506 | 3.0E-15 |
| sp|P10635|CP2D6_HUMAN | Cytochrome P450 2D6 OS=Homo sapiens GN=CYP2D6 PE=1 SV=2 | 269 | 537 | 3.0E-15 |
| sp|P17177|CP27A_RABIT | Sterol 26-hydroxylase, mitochondrial OS=Oryctolagus cuniculus GN=CYP27A1 PE=2 SV=1 | 338 | 539 | 3.0E-15 |
| sp|P79152|CP3AJ_CAPHE | Cytochrome P450 3A19 (Fragment) OS=Capra hircus aegagrus GN=CYP3A19 PE=2 SV=1 | 342 | 506 | 4.0E-15 |
| sp|P27786|CP17A_MOUSE | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Mus musculus GN=Cyp17a1 PE=1 SV=1 | 184 | 509 | 4.0E-15 |
| sp|A2RRT9|CP4V2_RAT | Cytochrome P450 4V2 OS=Rattus norvegicus GN=Cyp4v2 PE=2 SV=1 | 345 | 507 | 4.0E-15 |
| sp|Q2XNC9|CP2D6_PANPA | Cytochrome P450 2D6 OS=Pan paniscus GN=CYP2D6 PE=3 SV=1 | 269 | 537 | 4.0E-15 |
| sp|Q9K498|EIZFM_STRCO | Epi-isozizaene 5-monooxygenase/(E)-beta-farnesene synthase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5223 PE=1 SV=1 | 105 | 513 | 5.0E-15 |
| sp|P56590|CP1A1_CANLF | Cytochrome P450 1A1 OS=Canis lupus familiaris GN=CYP1A1 PE=2 SV=1 | 120 | 511 | 5.0E-15 |
| sp|Q9FI39|THAD_ARATH | Cytochrome P450 705A5 OS=Arabidopsis thaliana GN=CYP705A5 PE=2 SV=1 | 303 | 505 | 6.0E-15 |
| sp|Q02318|CP27A_HUMAN | Sterol 26-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27A1 PE=1 SV=1 | 338 | 510 | 6.0E-15 |
| sp|P52786|CP2J1_RABIT | Cytochrome P450 2J1 OS=Oryctolagus cuniculus GN=CYP2J1 PE=1 SV=2 | 69 | 507 | 6.0E-15 |
| sp|Q6UEG2|AFLN_ASPPA | P450 monooxygenase AflN OS=Aspergillus parasiticus GN=aflN PE=3 SV=1 | 343 | 522 | 7.0E-15 |
| sp|Q9LTL2|C71BP_ARATH | Cytochrome P450 71B25 OS=Arabidopsis thaliana GN=CYP71B25 PE=2 SV=1 | 308 | 536 | 8.0E-15 |
| sp|P11509|CP2A6_HUMAN | Cytochrome P450 2A6 OS=Homo sapiens GN=CYP2A6 PE=1 SV=3 | 120 | 504 | 9.0E-15 |
| sp|Q8CIM7|CP2DQ_MOUSE | Cytochrome P450 2D26 OS=Mus musculus GN=Cyp2d26 PE=1 SV=1 | 314 | 534 | 9.0E-15 |
| sp|Q9VVR9|C12C1_DROME | Probable cytochrome P450 12c1, mitochondrial OS=Drosophila melanogaster GN=Cyp12c1 PE=2 SV=2 | 344 | 508 | 1.0E-14 |
| sp|Q1ZXL7|C5083_DICDI | Probable cytochrome P450 508A3 OS=Dictyostelium discoideum GN=cyp508A3-1 PE=3 SV=1 | 216 | 519 | 1.0E-14 |
| sp|Q9VMS9|C4AC1_DROME | Probable cytochrome P450 4ac1 OS=Drosophila melanogaster GN=Cyp4ac1 PE=2 SV=1 | 310 | 504 | 1.0E-14 |
| sp|P30612|CP52P_CANTR | Cytochrome P450 52C1 OS=Candida tropicalis GN=CYP52C1 PE=2 SV=1 | 193 | 504 | 1.0E-14 |
| sp|Q9LTL8|C71BO_ARATH | Cytochrome P450 71B24 OS=Arabidopsis thaliana GN=CYP71B24 PE=2 SV=1 | 299 | 536 | 1.0E-14 |
| sp|Q54SK0|C508B_DICDI | Probable cytochrome P450 508B1 OS=Dictyostelium discoideum GN=cyp508B1 PE=3 SV=1 | 184 | 507 | 2.0E-14 |
| sp|Q9VXY0|CP4S3_DROME | Probable cytochrome P450 4s3 OS=Drosophila melanogaster GN=Cyp4s3 PE=3 SV=1 | 120 | 513 | 2.0E-14 |
| sp|O48921|C97B2_SOYBN | Cytochrome P450 97B2, chloroplastic OS=Glycine max GN=CYP97B2 PE=2 SV=1 | 163 | 522 | 2.0E-14 |
| sp|Q5KQT7|CP1A1_FELCA | Cytochrome P450 1A1 OS=Felis catus GN=CYP1A1 PE=2 SV=1 | 119 | 511 | 2.0E-14 |
| sp|Q95078|CP18A_DROME | Cytochrome P450 18a1 OS=Drosophila melanogaster GN=Cyp18a1 PE=2 SV=2 | 197 | 512 | 2.0E-14 |
| sp|Q964R1|CP6J1_BLAGE | Cytochrome P450 6j1 OS=Blattella germanica GN=CYP6J1 PE=2 SV=1 | 182 | 513 | 2.0E-14 |
| sp|Q9SD85|F3PH_ARATH | Flavonoid 3'-monooxygenase OS=Arabidopsis thaliana GN=CYP75B1 PE=1 SV=1 | 191 | 511 | 2.0E-14 |
| sp|Q2XNC8|CP2D6_PANTR | Cytochrome P450 2D6 OS=Pan troglodytes GN=CYP2D6 PE=3 SV=1 | 269 | 537 | 2.0E-14 |
| sp|Q9DBW0|CP4V2_MOUSE | Cytochrome P450 4V2 OS=Mus musculus GN=Cyp4v2 PE=1 SV=1 | 345 | 507 | 2.0E-14 |
| sp|P33272|CP2BC_RAT | Cytochrome P450 2B12 OS=Rattus norvegicus GN=Cyp2b12 PE=2 SV=1 | 95 | 504 | 2.0E-14 |
| sp|Q6WKY9|C7D95_MENGR | Cytochrome P450 71D95 OS=Mentha gracilis GN=CYP71D95 PE=1 SV=1 | 347 | 517 | 2.0E-14 |
| sp|P14581|CP4A7_RABIT | Cytochrome P450 4A7 OS=Oryctolagus cuniculus GN=CYP4A7 PE=1 SV=1 | 298 | 506 | 2.0E-14 |
| sp|B6SSW8|C14B3_MAIZE | Cytochrome P450 714B3 OS=Zea mays GN=CYP714B3 PE=2 SV=1 | 301 | 510 | 3.0E-14 |
| sp|Q16696|CP2AD_HUMAN | Cytochrome P450 2A13 OS=Homo sapiens GN=CYP2A13 PE=1 SV=3 | 120 | 507 | 3.0E-14 |
| sp|F4JW83|C84A4_ARATH | Cytochrome P450 84A4 OS=Arabidopsis thaliana GN=CYP84A4 PE=1 SV=1 | 303 | 537 | 3.0E-14 |
| sp|Q9XHE6|C71DF_MENPI | Cytochrome P450 71D15 OS=Mentha piperita GN=CYP71D15 PE=1 SV=1 | 210 | 517 | 3.0E-14 |
| sp|P47787|THAS_PIG | Thromboxane-A synthase OS=Sus scrofa GN=TBXAS1 PE=2 SV=1 | 177 | 510 | 4.0E-14 |
| sp|O17624|C13B1_CAEEL | Putative cytochrome P450 cyp-13B1 OS=Caenorhabditis elegans GN=cyp-13B1 PE=3 SV=2 | 148 | 505 | 4.0E-14 |
| sp|Q27589|CP4D2_DROME | Cytochrome P450 4d2 OS=Drosophila melanogaster GN=Cyp4d2 PE=2 SV=2 | 345 | 506 | 4.0E-14 |
| sp|Q6YTF5|C76M5_ORYSJ | Cytochrome P450 76M5 OS=Oryza sativa subsp. japonica GN=CYP76M5 PE=1 SV=1 | 344 | 538 | 4.0E-14 |
| sp|Q29473|CP2DF_CANLF | Cytochrome P450 2D15 OS=Canis lupus familiaris GN=CYP2D15 PE=1 SV=3 | 300 | 534 | 4.0E-14 |
| sp|Q43250|C71C1_MAIZE | 3-hydroxyindolin-2-one monooxygenase OS=Zea mays GN=CYP71C1 PE=1 SV=1 | 315 | 540 | 4.0E-14 |
| sp|P37122|C76A2_SOLME | Cytochrome P450 76A2 OS=Solanum melongena GN=CYP76A2 PE=2 SV=1 | 182 | 511 | 4.0E-14 |
| sp|O18992|CP2DJ_CALJA | Cytochrome P450 2D19 OS=Callithrix jacchus GN=CYP2D19 PE=2 SV=1 | 275 | 537 | 4.0E-14 |
| sp|O43174|CP26A_HUMAN | Cytochrome P450 26A1 OS=Homo sapiens GN=CYP26A1 PE=2 SV=2 | 67 | 511 | 4.0E-14 |
| sp|Q9LJY7|C75AK_ARATH | Cytochrome P450 705A20 OS=Arabidopsis thaliana GN=CYP705A20 PE=2 SV=1 | 335 | 506 | 5.0E-14 |
| sp|Q9W011|C4D20_DROME | Probable cytochrome P450 4d20 OS=Drosophila melanogaster GN=Cyp4d20 PE=3 SV=1 | 126 | 506 | 5.0E-14 |
| sp|Q42799|C93A2_SOYBN | Cytochrome P450 93A2 OS=Glycine max GN=CYP93A2 PE=2 SV=1 | 284 | 517 | 5.0E-14 |
| sp|P00184|CP1A1_MOUSE | Cytochrome P450 1A1 OS=Mus musculus GN=Cyp1a1 PE=1 SV=2 | 330 | 512 | 5.0E-14 |
| sp|P29980|CPXN_NOSS1 | Probable cytochrome P450 110 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cyp110 PE=3 SV=3 | 125 | 547 | 5.0E-14 |
| sp|O81970|C71A9_SOYBN | Cytochrome P450 71A9 OS=Glycine max GN=CYP71A9 PE=2 SV=1 | 221 | 511 | 5.0E-14 |
| sp|P56591|CP1A1_SHEEP | Cytochrome P450 1A1 OS=Ovis aries GN=CYP1A1 PE=2 SV=1 | 119 | 511 | 5.0E-14 |
| sp|Q43255|C71C2_MAIZE | indolin-2-one monooxygenase OS=Zea mays GN=CYP71C2 PE=1 SV=1 | 373 | 538 | 5.0E-14 |
| sp|Q6GUR1|CP1A1_MACMU | Cytochrome P450 1A1 OS=Macaca mulatta GN=CYP1A1 PE=2 SV=1 | 120 | 511 | 5.0E-14 |
| sp|P58048|C71B8_ARATH | Cytochrome P450 71B8 OS=Arabidopsis thaliana GN=CYP71B8 PE=3 SV=1 | 305 | 538 | 5.0E-14 |
| sp|Q9V559|CP4P3_DROME | Probable cytochrome P450 4p3 OS=Drosophila melanogaster GN=Cyp4p3 PE=2 SV=3 | 140 | 504 | 6.0E-14 |
| sp|P08682|CP2E1_RABIT | Cytochrome P450 2E1 OS=Oryctolagus cuniculus GN=CYP2E1 PE=2 SV=2 | 203 | 539 | 6.0E-14 |
| sp|Q3LFU0|CP1A1_BALAC | Cytochrome P450 1A1 OS=Balaenoptera acutorostrata GN=CYP1A1 PE=2 SV=1 | 120 | 511 | 7.0E-14 |
| sp|P33616|CP1A1_MACFA | Cytochrome P450 1A1 OS=Macaca fascicularis GN=CYP1A1 PE=2 SV=1 | 120 | 511 | 8.0E-14 |
| sp|P15149|CP2A2_RAT | Cytochrome P450 2A2 OS=Rattus norvegicus GN=Cyp2a2 PE=1 SV=1 | 120 | 508 | 8.0E-14 |
| sp|P20812|CP2A3_RAT | Cytochrome P450 2A3 OS=Rattus norvegicus GN=Cyp2a3 PE=2 SV=1 | 63 | 530 | 9.0E-14 |
| sp|P11715|CP17A_RAT | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Rattus norvegicus GN=Cyp17a1 PE=1 SV=2 | 347 | 509 | 9.0E-14 |
| sp|Q9V558|CP4P1_DROME | Cytochrome P450 4p1 OS=Drosophila melanogaster GN=Cyp4p1 PE=2 SV=1 | 344 | 504 | 1.0E-13 |
| sp|Q92090|CP2K1_ONCMY | Cytochrome P450 2K1 OS=Oncorhynchus mykiss GN=cyp2k1 PE=2 SV=1 | 331 | 534 | 1.0E-13 |
| sp|Q96SQ9|CP2S1_HUMAN | Cytochrome P450 2S1 OS=Homo sapiens GN=CYP2S1 PE=1 SV=2 | 120 | 507 | 1.0E-13 |
| sp|Q9V419|C28A5_DROME | Probable cytochrome P450 28a5 OS=Drosophila melanogaster GN=Cyp28a5 PE=2 SV=1 | 310 | 505 | 1.0E-13 |
| sp|P24456|CP2DA_MOUSE | Cytochrome P450 2D10 OS=Mus musculus GN=Cyp2d10 PE=1 SV=2 | 303 | 512 | 1.0E-13 |
| sp|P10611|CP4A4_RABIT | Cytochrome P450 4A4 OS=Oryctolagus cuniculus GN=CYP4A4 PE=1 SV=3 | 357 | 506 | 1.0E-13 |
| sp|Q6ZWL3|CP4V2_HUMAN | Cytochrome P450 4V2 OS=Homo sapiens GN=CYP4V2 PE=1 SV=2 | 138 | 507 | 1.0E-13 |
| sp|A3A871|C71Z6_ORYSJ | Ent-isokaurene C2-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP71Z6 PE=1 SV=1 | 344 | 517 | 1.0E-13 |
| sp|O35293|CP2F2_RAT | Cytochrome P450 2F2 OS=Rattus norvegicus GN=Cyp2f2 PE=2 SV=1 | 120 | 539 | 1.0E-13 |
| sp|P36423|THAS_MOUSE | Thromboxane-A synthase OS=Mus musculus GN=Tbxas1 PE=1 SV=2 | 337 | 510 | 1.0E-13 |
| sp|Q43240|TCMO_ZINVI | Trans-cinnamate 4-monooxygenase OS=Zinnia violacea GN=CYP73A12 PE=2 SV=1 | 286 | 524 | 1.0E-13 |
| sp|P03940|CP21A_MOUSE | Steroid 21-hydroxylase OS=Mus musculus GN=Cyp21 PE=2 SV=3 | 184 | 550 | 1.0E-13 |
| sp|P00185|CP1A1_RAT | Cytochrome P450 1A1 OS=Rattus norvegicus GN=Cyp1a1 PE=1 SV=1 | 330 | 512 | 2.0E-13 |
| sp|P00182|CP2C3_RABIT | Cytochrome P450 2C3 OS=Oryctolagus cuniculus GN=CYP2C3 PE=1 SV=2 | 210 | 514 | 2.0E-13 |
| sp|P33267|CP2F2_MOUSE | Cytochrome P450 2F2 OS=Mus musculus GN=Cyp2f2 PE=1 SV=1 | 95 | 507 | 2.0E-13 |
| sp|Q43078|C97B1_PEA | Cytochrome P450 97B1, chloroplastic OS=Pisum sativum GN=CYP97B1 PE=2 SV=1 | 163 | 496 | 2.0E-13 |
| sp|P20853|CP2A7_HUMAN | Cytochrome P450 2A7 OS=Homo sapiens GN=CYP2A7 PE=2 SV=2 | 95 | 504 | 2.0E-13 |
| sp|P24453|CP1A2_MESAU | Cytochrome P450 1A2 OS=Mesocricetus auratus GN=CYP1A2 PE=1 SV=4 | 56 | 511 | 2.0E-13 |
| sp|Q12587|CP52Q_CANMA | Cytochrome P450 52C2 OS=Candida maltosa GN=CYP52C2 PE=2 SV=1 | 193 | 510 | 2.0E-13 |
| sp|P79761|CP1A5_CHICK | Cytochrome P450 1A5 OS=Gallus gallus GN=CYP1A5 PE=2 SV=1 | 119 | 512 | 2.0E-13 |
| sp|O18596|C4D10_DROMT | Cytochrome P450 4d10 OS=Drosophila mettleri GN=Cyp4d10 PE=1 SV=1 | 183 | 538 | 2.0E-13 |
| sp|Q64680|CP2DI_RAT | Cytochrome P450 2D18 OS=Rattus norvegicus GN=Cyp2d18 PE=2 SV=1 | 303 | 534 | 3.0E-13 |
| sp|P11714|CP2D9_MOUSE | Cytochrome P450 2D9 OS=Mus musculus GN=Cyp2d9 PE=1 SV=2 | 314 | 541 | 3.0E-13 |
| sp|Q9SBQ9|F3PH_PETHY | Flavonoid 3'-monooxygenase OS=Petunia hybrida GN=CYP75B2 PE=2 SV=1 | 300 | 512 | 3.0E-13 |
| sp|O23365|C97B3_ARATH | Cytochrome P450 97B3, chloroplastic OS=Arabidopsis thaliana GN=CYP97B3 PE=2 SV=2 | 329 | 522 | 3.0E-13 |
| sp|Q5RCN6|CP4V2_PONAB | Cytochrome P450 4V2 OS=Pongo abelii GN=CYP4V2 PE=2 SV=1 | 138 | 507 | 3.0E-13 |
| sp|O81973|C93A3_SOYBN | Cytochrome P450 93A3 OS=Glycine max GN=CYP93A3 PE=2 SV=1 | 284 | 521 | 4.0E-13 |
| sp|P24457|CP2DB_MOUSE | Cytochrome P450 2D11 OS=Mus musculus GN=Cyp2d11 PE=2 SV=2 | 314 | 512 | 4.0E-13 |
| sp|O55071|CP2BJ_MOUSE | Cytochrome P450 2B19 OS=Mus musculus GN=Cyp2b19 PE=2 SV=1 | 95 | 529 | 4.0E-13 |
| sp|Q29510|CP2CU_RABIT | Cytochrome P450 2C30 OS=Oryctolagus cuniculus GN=CYP2C30 PE=2 SV=1 | 204 | 504 | 4.0E-13 |
| sp|Q01361|CP2DE_BOVIN | Cytochrome P450 2D14 OS=Bos taurus GN=CYP2D14 PE=2 SV=2 | 325 | 537 | 4.0E-13 |
| sp|P12790|CP2B9_MOUSE | Cytochrome P450 2B9 OS=Mus musculus GN=Cyp2b9 PE=1 SV=2 | 194 | 514 | 4.0E-13 |
| sp|Q42798|C93A1_SOYBN | 3,9-dihydroxypterocarpan 6A-monooxygenase OS=Glycine max GN=CYP93A1 PE=1 SV=1 | 284 | 542 | 4.0E-13 |
| sp|Q9V773|C6A20_DROME | Probable cytochrome P450 6a20 OS=Drosophila melanogaster GN=Cyp6a20 PE=2 SV=2 | 162 | 534 | 5.0E-13 |
| sp|Q9VLZ7|C4D21_DROME | Probable cytochrome P450 4d21 OS=Drosophila melanogaster GN=Cyp4d21 PE=3 SV=1 | 343 | 541 | 5.0E-13 |
| sp|Q9LHA1|C8D11_ARATH | Cytochrome P450 81D11 OS=Arabidopsis thaliana GN=CYP81D11 PE=2 SV=1 | 336 | 507 | 5.0E-13 |
| sp|Q8SPK0|CP4AP_PIG | Cytochrome P450 4A25 OS=Sus scrofa GN=CYP4A25 PE=2 SV=1 | 345 | 515 | 5.0E-13 |
| sp|P24903|CP2F1_HUMAN | Cytochrome P450 2F1 OS=Homo sapiens GN=CYP2F1 PE=1 SV=2 | 120 | 507 | 5.0E-13 |
| sp|Q9XHC6|C93E1_SOYBN | Beta-amyrin 24-hydroxylase OS=Glycine max GN=CYP93E1 PE=1 SV=1 | 344 | 537 | 5.0E-13 |
| sp|Q42797|TCMO_SOYBN | Trans-cinnamate 4-monooxygenase OS=Glycine max GN=CYP73A11 PE=2 SV=1 | 287 | 524 | 5.0E-13 |
| sp|Q9VCW1|CP6D4_DROME | Probable cytochrome P450 6d4 OS=Drosophila melanogaster GN=Cyp6d4 PE=2 SV=1 | 199 | 507 | 6.0E-13 |
| sp|Q8SPK1|CP4AO_PIG | Cytochrome P450 4A24 OS=Sus scrofa GN=CYP4A24 PE=2 SV=1 | 345 | 510 | 7.0E-13 |
| sp|Q8WNE1|CP2F5_GORGO | Cytochrome P450 2F5 OS=Gorilla gorilla gorilla GN=CYP2F5 PE=3 SV=2 | 120 | 507 | 7.0E-13 |
| sp|P20852|CP2A5_MOUSE | Cytochrome P450 2A5 OS=Mus musculus GN=Cyp2a5 PE=2 SV=1 | 63 | 529 | 7.0E-13 |
| sp|D5JBW8|GAO_CICIN | Germacrene A oxidase OS=Cichorium intybus PE=1 SV=1 | 347 | 517 | 7.0E-13 |
| sp|Q27518|C13A2_CAEEL | Putative cytochrome P450 CYP13A2 OS=Caenorhabditis elegans GN=cyp-13A2 PE=3 SV=1 | 184 | 507 | 8.0E-13 |
| sp|B9X287|C7346_ORYSJ | Cytochrome P450 734A6 OS=Oryza sativa subsp. japonica GN=CYP734A6 PE=2 SV=1 | 166 | 509 | 8.0E-13 |
| sp|Q9LTM7|C71BG_ARATH | Cytochrome P450 71B16 OS=Arabidopsis thaliana GN=CYP71B16 PE=3 SV=1 | 268 | 536 | 8.0E-13 |
| sp|Q9VB31|C6A18_DROME | Probable cytochrome P450 6a18 OS=Drosophila melanogaster GN=Cyp6a18 PE=2 SV=1 | 65 | 506 | 9.0E-13 |
| sp|P20817|CP4AE_RAT | Cytochrome P450 4A14 OS=Rattus norvegicus GN=Cyp4a14 PE=1 SV=2 | 345 | 506 | 9.0E-13 |
| sp|P14579|CP4A5_RABIT | Cytochrome P450 4A5 OS=Oryctolagus cuniculus GN=CYP4A5 PE=2 SV=1 | 357 | 506 | 9.0E-13 |
| sp|S4UX02|CYPH1_SALMI | Ferruginol synthase OS=Salvia miltiorrhiza GN=CYP76AH1 PE=1 SV=1 | 344 | 539 | 1.0E-12 |
| sp|L7X3S1|MSH_PAPSO | Methyltetrahydroprotoberberine 14-monooxygenase OS=Papaver somniferum GN=CYP82N4 PE=1 SV=1 | 192 | 517 | 1.0E-12 |
| sp|P08686|CP21A_HUMAN | Steroid 21-hydroxylase OS=Homo sapiens GN=CYP21A2 PE=1 SV=1 | 184 | 506 | 1.0E-12 |
| sp|Q54F47|C513C_DICDI | Probable cytochrome P450 513C1 OS=Dictyostelium discoideum GN=cyp513C1 PE=3 SV=1 | 180 | 506 | 1.0E-12 |
| sp|Q64410|CP17A_CAVPO | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Cavia porcellus GN=CYP17A1 PE=1 SV=1 | 182 | 511 | 1.0E-12 |
| sp|P47195|C80A1_BERST | Berbamunine synthase OS=Berberis stolonifera GN=CYP80A1 PE=1 SV=1 | 183 | 539 | 1.0E-12 |
| sp|E9Q816|CP2W1_MOUSE | Cytochrome P450 2W1 OS=Mus musculus GN=Cyp2w1 PE=2 SV=1 | 191 | 529 | 1.0E-12 |
| sp|P90771|C36A1_CAEEL | Probable cytochrome P450 CYP36A1 OS=Caenorhabditis elegans GN=cyp-36A1 PE=3 SV=2 | 199 | 527 | 1.0E-12 |
| sp|P11371|CP2C4_RABIT | Cytochrome P450 2C4 OS=Oryctolagus cuniculus GN=CYP2C4 PE=2 SV=1 | 291 | 530 | 1.0E-12 |
| sp|Q9VVN6|CP312_DROME | Probable cytochrome P450 312a1 OS=Drosophila melanogaster GN=Cyp312a1 PE=2 SV=1 | 344 | 507 | 1.0E-12 |
| sp|Q6WNQ8|C81E8_MEDTR | Cytochrome P450 81E8 OS=Medicago truncatula GN=CYP81E8 PE=2 SV=1 | 337 | 517 | 1.0E-12 |
| sp|Q9VYQ7|CP311_DROME | Probable cytochrome P450 311a1 OS=Drosophila melanogaster GN=Cyp311a1 PE=2 SV=1 | 122 | 510 | 1.0E-12 |
| sp|Q96423|TCMO_GLYEC | Trans-cinnamate 4-monooxygenase OS=Glycyrrhiza echinata GN=CYP73A14 PE=2 SV=1 | 287 | 524 | 1.0E-12 |
| sp|O65782|C83B1_ARATH | Cytochrome P450 83B1 OS=Arabidopsis thaliana GN=CYP83B1 PE=1 SV=1 | 344 | 517 | 1.0E-12 |
| sp|Q92148|CP1A1_MICTO | Cytochrome P450 1A1 OS=Microgadus tomcod GN=cyp1a1 PE=2 SV=1 | 309 | 512 | 1.0E-12 |
| sp|Q9GJX5|CP4AL_PIG | Taurochenodeoxycholic 6 alpha-hydroxylase OS=Sus scrofa GN=CYP4A21 PE=1 SV=1 | 347 | 510 | 2.0E-12 |
| sp|H1A981|C7263_MEDTR | 11-oxo-beta-amyrin 30-oxidase OS=Medicago truncatula GN=CYP72A63 PE=1 SV=1 | 120 | 511 | 2.0E-12 |
| sp|Q9V9L1|CP6W1_DROME | Probable cytochrome P450 6w1 OS=Drosophila melanogaster GN=Cyp6w1 PE=2 SV=1 | 190 | 506 | 2.0E-12 |
| sp|Q9LTM3|C71BK_ARATH | Cytochrome P450 71B20 OS=Arabidopsis thaliana GN=CYP71B20 PE=2 SV=1 | 181 | 536 | 2.0E-12 |
| sp|O46658|CP2DP_PIG | Vitamin D(3) 25-hydroxylase OS=Sus scrofa GN=CYP2D25 PE=1 SV=3 | 347 | 512 | 2.0E-12 |
| sp|P10632|CP2C8_HUMAN | Cytochrome P450 2C8 OS=Homo sapiens GN=CYP2C8 PE=1 SV=2 | 81 | 507 | 2.0E-12 |
| sp|P24465|C71A1_PERAE | Cytochrome P450 71A1 OS=Persea americana GN=CYP71A1 PE=1 SV=2 | 307 | 537 | 2.0E-12 |
| sp|P14580|CP4A6_RABIT | Cytochrome P450 4A6 OS=Oryctolagus cuniculus GN=CYP4A6 PE=1 SV=1 | 298 | 506 | 2.0E-12 |
| sp|Q9XHE8|C71DI_MENSP | Cytochrome P450 71D18 OS=Mentha spicata GN=CYP71D18 PE=1 SV=1 | 335 | 542 | 2.0E-12 |
| sp|Q6WKZ1|C71DI_MENGR | Cytochrome P450 71D18 OS=Mentha gracilis GN=CYP71D18 PE=1 SV=1 | 335 | 542 | 2.0E-12 |
| sp|P48421|C83A1_ARATH | Cytochrome P450 83A1 OS=Arabidopsis thaliana GN=CYP83A1 PE=1 SV=2 | 344 | 517 | 2.0E-12 |
| sp|Q12589|CP52K_CANMA | Cytochrome P450 52A11 OS=Candida maltosa GN=CYP52A11 PE=2 SV=1 | 344 | 510 | 2.0E-12 |
| sp|P49430|THAS_RAT | Thromboxane-A synthase OS=Rattus norvegicus GN=Tbxas1 PE=2 SV=1 | 177 | 510 | 2.0E-12 |
| sp|A0A087X1C5|CP2D7_HUMAN | Putative cytochrome P450 2D7 OS=Homo sapiens GN=CYP2D7 PE=5 SV=1 | 269 | 537 | 2.0E-12 |
| sp|P30437|CP17A_ONCMY | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oncorhynchus mykiss GN=cyp17a1 PE=2 SV=1 | 200 | 512 | 2.0E-12 |
| sp|Q0DBF4|C7018_ORYSJ | Ent-sandaracopimaradiene 3-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP701A8 PE=1 SV=1 | 126 | 512 | 2.0E-12 |
| sp|Q964R0|CP6K1_BLAGE | Cytochrome P450 6k1 OS=Blattella germanica GN=CYP6K1 PE=2 SV=1 | 190 | 535 | 2.0E-12 |
| sp|Q64391|CP1A2_CAVPO | Cytochrome P450 1A2 OS=Cavia porcellus GN=CYP1A2 PE=2 SV=1 | 120 | 511 | 2.0E-12 |
| sp|Q9LSF8|C82G1_ARATH | Cytochrome P450 82G1 OS=Arabidopsis thaliana GN=CYP82G1 PE=1 SV=1 | 191 | 506 | 2.0E-12 |
| sp|Q12588|CP52J_CANMA | Cytochrome P450 52A10 OS=Candida maltosa GN=CYP52A10 PE=2 SV=1 | 344 | 510 | 2.0E-12 |
| sp|Q9V557|CP4P2_DROME | Probable cytochrome P450 4p2 OS=Drosophila melanogaster GN=Cyp4p2 PE=2 SV=1 | 158 | 504 | 2.0E-12 |
| sp|Q6R7M4|C15A1_DIPPU | Methyl farnesoate epoxidase OS=Diploptera punctata GN=CYP15A1 PE=1 SV=1 | 309 | 537 | 2.0E-12 |
| sp|P82713|CP392_DROME | Probable cytochrome P450 309a2 OS=Drosophila melanogaster GN=Cyp309a2 PE=2 SV=2 | 331 | 504 | 3.0E-12 |
| sp|P05176|CP1A1_RABIT | Cytochrome P450 1A1 OS=Oryctolagus cuniculus GN=CYP1A1 PE=2 SV=1 | 91 | 511 | 3.0E-12 |
| sp|O81972|C82A2_SOYBN | Cytochrome P450 82A2 OS=Glycine max GN=CYP82A2 PE=2 SV=1 | 297 | 542 | 3.0E-12 |
| sp|D5J9U8|GAO_LACSA | Germacrene A oxidase OS=Lactuca sativa GN=GAO1 PE=1 SV=1 | 373 | 517 | 3.0E-12 |
| sp|O18635|C12A2_MUSDO | Cytochrome P450 CYP12A2 OS=Musca domestica GN=CYP12A2 PE=2 SV=1 | 344 | 508 | 3.0E-12 |
| sp|Q00557|CP1A1_MESAU | Cytochrome P450 1A1 OS=Mesocricetus auratus GN=CYP1A1 PE=2 SV=2 | 91 | 512 | 3.0E-12 |
| sp|Q9GMC8|CP17A_FELCA | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Felis catus GN=CYP17A1 PE=2 SV=1 | 197 | 507 | 3.0E-12 |
| sp|G3GBK0|C7BL3_CICIN | Costunolide synthase OS=Cichorium intybus GN=CYP71BL3 PE=1 SV=1 | 300 | 540 | 3.0E-12 |
| sp|O42430|CP1A1_LIMLI | Cytochrome P450 1A1 OS=Limanda limanda GN=cyp1a1 PE=2 SV=1 | 62 | 512 | 3.0E-12 |
| sp|P15129|CP4B1_RAT | Cytochrome P450 4B1 OS=Rattus norvegicus GN=Cyp4b1 PE=1 SV=3 | 314 | 512 | 3.0E-12 |
| sp|Q964T2|CP9E2_BLAGE | Cytochrome P450 9e2 OS=Blattella germanica GN=CYP9E2 PE=2 SV=1 | 178 | 507 | 3.0E-12 |
| sp|Q9FVS9|C96AF_ARATH | Alkane hydroxylase MAH1 OS=Arabidopsis thaliana GN=CYP96A15 PE=2 SV=1 | 319 | 511 | 3.0E-12 |
| sp|P37115|TCMO_VIGRR | Trans-cinnamate 4-monooxygenase OS=Vigna radiata var. radiata GN=CYP73A2 PE=1 SV=1 | 287 | 524 | 4.0E-12 |
| sp|Q06367|CP1A1_CAVPO | Cytochrome P450 1A1 OS=Cavia porcellus GN=CYP1A1 PE=1 SV=1 | 65 | 544 | 4.0E-12 |
| sp|P15540|CP21A_PIG | Steroid 21-hydroxylase OS=Sus scrofa GN=CYP21 PE=1 SV=2 | 184 | 506 | 4.0E-12 |
| sp|P37120|C75A2_SOLME | Flavonoid 3',5'-hydroxylase OS=Solanum melongena GN=CYP75A2 PE=2 SV=1 | 300 | 508 | 4.0E-12 |
| sp|Q6YTF1|C76M8_ORYSJ | Oryzalexin D synthase OS=Oryza sativa subsp. japonica GN=CYP76M8 PE=1 SV=1 | 337 | 540 | 4.0E-12 |
| sp|Q27519|C13A7_CAEEL | Putative cytochrome P450 CYP13A7 OS=Caenorhabditis elegans GN=cyp-13A7 PE=3 SV=1 | 178 | 510 | 4.0E-12 |
| sp|D1MI46|C76BA_SWEMU | Geraniol 8-hydroxylase OS=Swertia mussotii GN=CYP76B10 PE=1 SV=1 | 344 | 511 | 4.0E-12 |
| sp|Q9VA27|CP4C3_DROME | Cytochrome P450 4c3 OS=Drosophila melanogaster GN=Cyp4c3 PE=2 SV=1 | 320 | 507 | 4.0E-12 |
| sp|Q9LTM4|C71BJ_ARATH | Cytochrome P450 71B19 OS=Arabidopsis thaliana GN=CYP71B19 PE=2 SV=1 | 181 | 536 | 5.0E-12 |
| sp|Q9DBX6|CP2S1_MOUSE | Cytochrome P450 2S1 OS=Mus musculus GN=Cyp2s1 PE=1 SV=1 | 120 | 507 | 5.0E-12 |
| sp|O64635|C76C4_ARATH | Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CYP76C4 PE=3 SV=1 | 344 | 517 | 5.0E-12 |
| sp|Q02928|CP4AB_HUMAN | Cytochrome P450 4A11 OS=Homo sapiens GN=CYP4A11 PE=1 SV=1 | 345 | 506 | 5.0E-12 |
| sp|Q9V4T5|CP4E1_DROME | Probable cytochrome P450 4e1 OS=Drosophila melanogaster GN=Cyp4e1 PE=2 SV=1 | 127 | 530 | 5.0E-12 |
| sp|O35728|CP4AE_MOUSE | Cytochrome P450 4A14 OS=Mus musculus GN=Cyp4a14 PE=1 SV=1 | 345 | 505 | 5.0E-12 |
| sp|Q92109|CP1A3_ONCMY | Cytochrome P450 1A3 OS=Oncorhynchus mykiss GN=cyp1a3 PE=2 SV=2 | 57 | 511 | 5.0E-12 |
| sp|P24454|CP2A8_MESAU | Cytochrome P450 2A8 OS=Mesocricetus auratus GN=CYP2A8 PE=1 SV=1 | 91 | 507 | 6.0E-12 |
| sp|P33265|CP2CS_MESAU | Cytochrome P450 2C28 OS=Mesocricetus auratus GN=CYP2C28 PE=2 SV=1 | 203 | 537 | 6.0E-12 |
| sp|P15128|CP4B1_RABIT | Cytochrome P450 4B1 OS=Oryctolagus cuniculus GN=CYP4B1 PE=1 SV=1 | 308 | 510 | 6.0E-12 |
| sp|Q9LTM6|C71BH_ARATH | Cytochrome P450 71B17 OS=Arabidopsis thaliana GN=CYP71B17 PE=3 SV=1 | 268 | 536 | 6.0E-12 |
| sp|P33264|CP2CR_MESAU | Cytochrome P450 2C27 OS=Mesocricetus auratus GN=CYP2C27 PE=2 SV=1 | 210 | 507 | 6.0E-12 |
| sp|Q96418|C75A5_EUSER | Flavonoid 3',5'-hydroxylase OS=Eustoma exaltatum subsp. russellianum GN=CYP75A5 PE=2 SV=1 | 311 | 508 | 6.0E-12 |
| sp|P10634|CP2DQ_RAT | Cytochrome P450 2D26 OS=Rattus norvegicus GN=Cyp2d26 PE=1 SV=2 | 303 | 511 | 6.0E-12 |
| sp|Q04468|TCMO_HELTU | Trans-cinnamate 4-monooxygenase OS=Helianthus tuberosus GN=CYP73A1 PE=1 SV=1 | 286 | 516 | 6.0E-12 |
| sp|P04799|CP1A2_RAT | Cytochrome P450 1A2 OS=Rattus norvegicus GN=Cyp1a2 PE=1 SV=2 | 91 | 511 | 7.0E-12 |
| sp|Q69X58|C76M7_ORYSJ | Ent-cassadiene C11-alpha-hydroxylase 1 OS=Oryza sativa subsp. japonica GN=CYP76M7 PE=1 SV=1 | 345 | 517 | 7.0E-12 |
| sp|Q9Y758|CP52M_DEBHN | Cytochrome P450 52A13 OS=Debaryomyces hansenii GN=CYP52A13 PE=2 SV=1 | 210 | 505 | 7.0E-12 |
| sp|Q2LCM1|CP21A_CANLU | Steroid 21-hydroxylase OS=Canis lupus GN=CYP21 PE=3 SV=1 | 184 | 511 | 7.0E-12 |
| sp|Q8WNW0|CP21A_CANLF | Steroid 21-hydroxylase OS=Canis lupus familiaris GN=CYP21 PE=3 SV=1 | 184 | 511 | 7.0E-12 |
| sp|Q9GQM9|CP6L1_BLAGE | Cytochrome P450 6l1 OS=Blattella germanica GN=CYP6L1 PE=2 SV=1 | 184 | 538 | 7.0E-12 |
| sp|P13584|CP4B1_HUMAN | Cytochrome P450 4B1 OS=Homo sapiens GN=CYP4B1 PE=1 SV=2 | 345 | 511 | 7.0E-12 |
| sp|O54750|CP2J6_MOUSE | Cytochrome P450 2J6 OS=Mus musculus GN=Cyp2j6 PE=2 SV=2 | 194 | 506 | 7.0E-12 |
| sp|P93147|C81E1_GLYEC | Isoflavone 2'-hydroxylase OS=Glycyrrhiza echinata GN=CYP81E1 PE=1 SV=2 | 344 | 536 | 7.0E-12 |
| sp|Q6YV88|C71Z7_ORYSJ | Ent-cassadiene C2-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP71Z7 PE=1 SV=1 | 320 | 547 | 8.0E-12 |
| sp|O65786|C71B4_ARATH | Cytochrome P450 71B4 OS=Arabidopsis thaliana GN=CYP71B4 PE=2 SV=2 | 347 | 539 | 9.0E-12 |
| sp|Q27520|C13A1_CAEEL | Putative cytochrome P450 CYP13A1 OS=Caenorhabditis elegans GN=cyp-13A1 PE=3 SV=1 | 184 | 544 | 9.0E-12 |
| sp|Q8K4D6|CP4X1_RAT | Cytochrome P450 4X1 OS=Rattus norvegicus GN=Cyp4x1 PE=2 SV=1 | 347 | 504 | 9.0E-12 |
| sp|P24461|CP2G1_RABIT | Cytochrome P450 2G1 OS=Oryctolagus cuniculus GN=CYP2G1 PE=1 SV=1 | 186 | 504 | 1.0E-11 |
| sp|Q09653|C13AA_CAEEL | Putative cytochrome P450 CYP13A10 OS=Caenorhabditis elegans GN=cyp-13A10 PE=3 SV=3 | 184 | 544 | 1.0E-11 |
| sp|Q43054|TCMO_POPKI | Trans-cinnamate 4-monooxygenase OS=Populus kitakamiensis GN=CYP73A16 PE=2 SV=1 | 287 | 524 | 1.0E-11 |
| sp|Q05556|CP2AB_RABIT | Cytochrome P450 2A11 OS=Oryctolagus cuniculus GN=CYP2A11 PE=1 SV=1 | 344 | 506 | 1.0E-11 |
| sp|P05181|CP2E1_HUMAN | Cytochrome P450 2E1 OS=Homo sapiens GN=CYP2E1 PE=1 SV=1 | 210 | 507 | 1.0E-11 |
| sp|Q9SP06|C80B3_PAPSO | (S)-N-methylcoclaurine 3'-hydroxylase isozyme 1 (Fragment) OS=Papaver somniferum GN=CYP80B3 PE=1 SV=1 | 347 | 539 | 1.0E-11 |
| sp|Q9V8M2|C12B2_DROME | Probable cytochrome P450 12b2, mitochondrial OS=Drosophila melanogaster GN=Cyp12b2 PE=2 SV=2 | 344 | 510 | 1.0E-11 |
| sp|P51589|CP2J2_HUMAN | Cytochrome P450 2J2 OS=Homo sapiens GN=CYP2J2 PE=1 SV=2 | 194 | 506 | 1.0E-11 |
| sp|Q9V4T3|C4AD1_DROME | Probable cytochrome P450 4ad1 OS=Drosophila melanogaster GN=Cyp4ad1 PE=2 SV=1 | 337 | 514 | 1.0E-11 |
| sp|A6YIH8|C7D55_HYOMU | Premnaspirodiene oxygenase OS=Hyoscyamus muticus GN=CYP71D55 PE=1 SV=1 | 347 | 517 | 1.0E-11 |
| sp|Q6XVG2|CP254_MOUSE | Cytochrome P450 2C54 OS=Mus musculus GN=Cyp2c54 PE=1 SV=1 | 210 | 507 | 1.0E-11 |
| sp|Q6A152|CP4X1_MOUSE | Cytochrome P450 4X1 OS=Mus musculus GN=Cyp4x1 PE=1 SV=1 | 347 | 504 | 1.0E-11 |
| sp|O24312|TCMO_POPTM | Trans-cinnamate 4-monooxygenase OS=Populus tremuloides GN=CYP73A13 PE=2 SV=1 | 287 | 524 | 2.0E-11 |
| sp|P04798|CP1A1_HUMAN | Cytochrome P450 1A1 OS=Homo sapiens GN=CYP1A1 PE=1 SV=1 | 330 | 511 | 2.0E-11 |
| sp|Q16678|CP1B1_HUMAN | Cytochrome P450 1B1 OS=Homo sapiens GN=CYP1B1 PE=1 SV=2 | 328 | 555 | 2.0E-11 |
| sp|Q42600|C84A1_ARATH | Cytochrome P450 84A1 OS=Arabidopsis thaliana GN=CYP84A1 PE=1 SV=1 | 344 | 539 | 2.0E-11 |
| sp|P92994|TCMO_ARATH | Trans-cinnamate 4-monooxygenase OS=Arabidopsis thaliana GN=CYP73A5 PE=2 SV=1 | 363 | 524 | 2.0E-11 |
| sp|Q9VE00|C12A4_DROME | Probable cytochrome P450 12a4, mitochondrial OS=Drosophila melanogaster GN=Cyp12a4 PE=2 SV=2 | 344 | 514 | 2.0E-11 |
| sp|P17666|CP2CE_RABIT | Cytochrome P450 2C14 OS=Oryctolagus cuniculus GN=CYP2C14 PE=2 SV=1 | 210 | 504 | 2.0E-11 |
| sp|P00179|CP2C5_RABIT | Cytochrome P450 2C5 OS=Oryctolagus cuniculus GN=CYP2C5 PE=1 SV=2 | 210 | 530 | 2.0E-11 |
| sp|Q92100|CP1A1_PLEPL | Cytochrome P450 1A1 OS=Pleuronectes platessa GN=cyp1a1 PE=2 SV=1 | 309 | 512 | 2.0E-11 |
| sp|O04773|C75A6_CAMME | Flavonoid 3',5'-hydroxylase OS=Campanula medium GN=CYP75A6 PE=2 SV=1 | 288 | 517 | 2.0E-11 |
| sp|P20816|CP4A2_RAT | Cytochrome P450 4A2 OS=Rattus norvegicus GN=Cyp4a2 PE=1 SV=2 | 345 | 506 | 2.0E-11 |
| sp|O93297|CP2K4_ONCMY | Cytochrome P450 2K4 OS=Oncorhynchus mykiss GN=cyp2k4 PE=2 SV=1 | 360 | 534 | 2.0E-11 |
| sp|Q9VW43|CP305_DROME | Probable cytochrome P450 305a1 OS=Drosophila melanogaster GN=Cyp305a1 PE=2 SV=1 | 198 | 534 | 2.0E-11 |
| sp|P79402|CP242_PIG | Cytochrome P450 2C42 (Fragment) OS=Sus scrofa GN=CYP2C42 PE=2 SV=1 | 347 | 529 | 2.0E-11 |
| sp|Q9V4U9|C6A13_DROME | Probable cytochrome P450 6a13 OS=Drosophila melanogaster GN=Cyp6a13 PE=2 SV=1 | 184 | 506 | 2.0E-11 |
| sp|P48522|TCMO_CATRO | Trans-cinnamate 4-monooxygenase OS=Catharanthus roseus GN=CYP73A4 PE=2 SV=1 | 363 | 524 | 2.0E-11 |
| sp|Q9SZ46|C82C4_ARATH | Cytochrome P450 82C4 OS=Arabidopsis thaliana GN=CYP82C4 PE=2 SV=1 | 344 | 507 | 2.0E-11 |
| sp|P24460|CP2BB_CANLF | Cytochrome P450 2B11 OS=Canis lupus familiaris GN=CYP2B11 PE=2 SV=1 | 123 | 515 | 2.0E-11 |
| sp|P15123|CP2CG_RABIT | Cytochrome P450 2C16 OS=Oryctolagus cuniculus GN=CYP2C16 PE=2 SV=1 | 210 | 530 | 2.0E-11 |
| sp|Q9V7G5|C4AA1_DROME | Probable cytochrome P450 4aa1 OS=Drosophila melanogaster GN=Cyp4aa1 PE=2 SV=2 | 139 | 504 | 3.0E-11 |
| sp|Q9LTM1|C71BM_ARATH | Cytochrome P450 71B22 OS=Arabidopsis thaliana GN=CYP71B22 PE=2 SV=1 | 300 | 536 | 3.0E-11 |
| sp|Q8N118|CP4X1_HUMAN | Cytochrome P450 4X1 OS=Homo sapiens GN=CYP4X1 PE=2 SV=1 | 301 | 504 | 3.0E-11 |
| sp|Q9YH64|CP1A1_PLAFE | Cytochrome P450 1A1 OS=Platichthys flesus GN=cyp1a1 PE=3 SV=1 | 321 | 512 | 3.0E-11 |
| sp|Q86W10|CP4Z1_HUMAN | Cytochrome P450 4Z1 OS=Homo sapiens GN=CYP4Z1 PE=2 SV=1 | 345 | 504 | 3.0E-11 |
| sp|O48956|C98A1_SORBI | Cytochrome P450 98A1 OS=Sorghum bicolor GN=CYP98A1 PE=2 SV=1 | 337 | 558 | 3.0E-11 |
| sp|Q54ZM4|C518A_DICDI | Probable cytochrome P450 518A1 OS=Dictyostelium discoideum GN=cyp518A1 PE=3 SV=1 | 393 | 504 | 3.0E-11 |
| sp|Q9VGH1|CP315_DROME | Cytochrome P450 315a1, mitochondrial OS=Drosophila melanogaster GN=sad PE=2 SV=1 | 341 | 506 | 3.0E-11 |
| sp|P56654|CP237_MOUSE | Cytochrome P450 2C37 OS=Mus musculus GN=Cyp2c37 PE=1 SV=2 | 95 | 507 | 3.0E-11 |
| sp|O65788|C71B2_ARATH | Cytochrome P450 71B2 OS=Arabidopsis thaliana GN=CYP71B2 PE=2 SV=2 | 307 | 536 | 4.0E-11 |
| sp|Q6GUQ4|CP2E1_MACMU | Cytochrome P450 2E1 OS=Macaca mulatta GN=CYP2E1 PE=2 SV=1 | 210 | 507 | 4.0E-11 |
| sp|Q9V770|C6A17_DROME | Probable cytochrome P450 6a17 OS=Drosophila melanogaster GN=Cyp6a17 PE=2 SV=1 | 161 | 510 | 4.0E-11 |
| sp|Q9PUB4|CP26A_CHICK | Cytochrome P450 26A1 OS=Gallus gallus GN=CYP26A1 PE=2 SV=1 | 118 | 511 | 4.0E-11 |
| sp|P56657|CP240_MOUSE | Cytochrome P450 2C40 OS=Mus musculus GN=Cyp2c40 PE=1 SV=2 | 95 | 530 | 4.0E-11 |
| sp|F8S1I0|C7BL2_LACSA | Costunolide synthase OS=Lactuca sativa GN=CYP71BL2 PE=1 SV=1 | 300 | 539 | 4.0E-11 |
| sp|P15392|CP2A4_MOUSE | Cytochrome P450 2A4 OS=Mus musculus GN=Cyp2a4 PE=2 SV=3 | 333 | 529 | 4.0E-11 |
| sp|P12394|CP17A_CHICK | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Gallus gallus GN=CYP17A1 PE=2 SV=1 | 200 | 507 | 4.0E-11 |
| sp|P11372|CP2CF_RABIT | Cytochrome P450 2C15 (Fragment) OS=Oryctolagus cuniculus GN=CYP2C15 PE=2 SV=1 | 210 | 530 | 4.0E-11 |
| sp|O04790|C75A7_EUSER | Flavonoid 3',5'-hydroxylase OS=Eustoma exaltatum subsp. russellianum GN=CYP75A7 PE=2 SV=1 | 311 | 508 | 4.0E-11 |
| sp|E1B2Z9|C7AV8_CICIN | Cytochrome P450 71AV8 OS=Cichorium intybus GN=CYP71AV8 PE=2 SV=1 | 347 | 517 | 4.0E-11 |
| sp|Q50EK4|C75A1_PINTA | Cytochrome P450 750A1 OS=Pinus taeda GN=CYP750A1 PE=2 SV=1 | 314 | 539 | 4.0E-11 |
| sp|P05179|CP2C7_RAT | Cytochrome P450 2C7 OS=Rattus norvegicus GN=Cyp2c7 PE=1 SV=2 | 210 | 507 | 4.0E-11 |
| sp|Q9FIB0|C78A7_ARATH | Cytochrome P450 78A7 OS=Arabidopsis thaliana GN=CYP78A7 PE=2 SV=1 | 308 | 516 | 4.0E-11 |
| sp|Q9ZNR0|C78A6_ARATH | Cytochrome P450 78A6 OS=Arabidopsis thaliana GN=CYP78A6 PE=2 SV=1 | 344 | 517 | 4.0E-11 |
| sp|P00176|CP2B1_RAT | Cytochrome P450 2B1 OS=Rattus norvegicus GN=Cyp2b1 PE=1 SV=1 | 122 | 514 | 4.0E-11 |
| sp|P56594|CP2CL_CANLF | Cytochrome P450 2C21 (Fragment) OS=Canis lupus familiaris GN=CYP2C21 PE=2 SV=2 | 271 | 504 | 5.0E-11 |
| sp|Q9SWR5|C93C1_SOYBN | 2-hydroxyisoflavanone synthase OS=Glycine max GN=IFS2 PE=2 SV=1 | 330 | 507 | 5.0E-11 |
| sp|P56592|CP1A2_CANLF | Cytochrome P450 1A2 OS=Canis lupus familiaris GN=CYP1A2 PE=1 SV=2 | 120 | 511 | 5.0E-11 |
| sp|P08516|CP4AA_RAT | Cytochrome P450 4A10 OS=Rattus norvegicus GN=Cyp4a10 PE=1 SV=2 | 357 | 505 | 5.0E-11 |
| sp|Q8VWZ7|C76B6_CATRO | Geraniol 8-hydroxylase OS=Catharanthus roseus GN=CYP76B6 PE=1 SV=1 | 344 | 536 | 5.0E-11 |
| sp|P13107|CP2B3_RAT | Cytochrome P450 2B3 OS=Rattus norvegicus GN=Cyp2b3 PE=2 SV=1 | 197 | 517 | 5.0E-11 |
| sp|P70687|CP17A_MESAU | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Mesocricetus auratus GN=CYP17A1 PE=2 SV=1 | 337 | 537 | 5.0E-11 |
| sp|Q92095|CP1A1_OPSTA | Cytochrome P450 1A1 OS=Opsanus tau GN=cyp1a1 PE=2 SV=1 | 309 | 512 | 6.0E-11 |
| sp|Q5IZM4|CP51_MYCVP | Lanosterol 14-alpha demethylase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=cyp51 PE=3 SV=1 | 314 | 509 | 6.0E-11 |
| sp|Q91W64|CP270_MOUSE | Cytochrome P450 2C70 OS=Mus musculus GN=Cyp2c70 PE=1 SV=2 | 214 | 504 | 6.0E-11 |
| sp|Q9V5L3|C49A1_DROME | Probable cytochrome P450 49a1 OS=Drosophila melanogaster GN=Cyp49a1 PE=2 SV=3 | 344 | 512 | 6.0E-11 |
| sp|Q9W223|CP6D2_DROME | Probable cytochrome P450 6d2 OS=Drosophila melanogaster GN=Cyp6d2 PE=2 SV=1 | 343 | 537 | 6.0E-11 |
| sp|Q55AJ4|C516B_DICDI | Probable cytochrome P450 516B1 OS=Dictyostelium discoideum GN=cyp516B1 PE=3 SV=1 | 344 | 513 | 7.0E-11 |
| sp|Q9VJ71|CP310_DROME | Probable cytochrome P450 310a1 OS=Drosophila melanogaster GN=Cyp310a1 PE=2 SV=1 | 350 | 515 | 7.0E-11 |
| sp|P10633|CP2D1_RAT | Cytochrome P450 2D1 OS=Rattus norvegicus GN=Cyp2d1 PE=2 SV=1 | 314 | 541 | 7.0E-11 |
| sp|Q9W683|CP1A1_LIZSA | Cytochrome P450 1A1 OS=Liza saliens GN=cyp1a1 PE=2 SV=1 | 56 | 512 | 7.0E-11 |
| sp|O49858|C82A3_SOYBN | Cytochrome P450 82A3 OS=Glycine max GN=CYP82A3 PE=2 SV=1 | 304 | 543 | 7.0E-11 |
| sp|O88833|CP4AA_MOUSE | Cytochrome P450 4A10 OS=Mus musculus GN=Cyp4a10 PE=2 SV=2 | 357 | 505 | 7.0E-11 |
| sp|Q05421|CP2E1_MOUSE | Cytochrome P450 2E1 OS=Mus musculus GN=Cyp2e1 PE=1 SV=1 | 210 | 537 | 8.0E-11 |
| sp|D5JBX0|GAO_HELAN | Germacrene A oxidase OS=Helianthus annuus PE=1 SV=1 | 373 | 517 | 9.0E-11 |
| sp|P12939|CP2DA_RAT | Cytochrome P450 2D10 OS=Rattus norvegicus GN=Cyp2d10 PE=1 SV=1 | 314 | 541 | 9.0E-11 |
| sp|Q9SCN2|C71BU_ARATH | Cytochrome P450 71B31 OS=Arabidopsis thaliana GN=CYP71B31 PE=2 SV=1 | 320 | 538 | 9.0E-11 |
| sp|Q0DS59|C14B2_ORYSJ | Cytochrome P450 714B2 OS=Oryza sativa subsp. japonica GN=CYP714B2 PE=1 SV=2 | 301 | 510 | 9.0E-11 |
| sp|Q9LTM2|C71BL_ARATH | Cytochrome P450 71B21 OS=Arabidopsis thaliana GN=CYP71B21 PE=3 SV=1 | 312 | 536 | 9.0E-11 |
| sp|Q92116|CP1A1_STECH | Cytochrome P450 1A1 OS=Stenotomus chrysops GN=cyp1a1 PE=2 SV=1 | 56 | 512 | 1.0E-10 |
| sp|L7X0L7|P6H_PAPSO | Protopine 6-monooxygenase OS=Papaver somniferum GN=CYP82N3 PE=2 SV=1 | 192 | 543 | 1.0E-10 |
| sp|Q6WNR0|C81E7_MEDTR | Isoflavone 2'-hydroxylase OS=Medicago truncatula GN=CYP81E7 PE=1 SV=1 | 344 | 539 | 1.0E-10 |
| sp|Q92039|CP1A1_CHACA | Cytochrome P450 1A1 OS=Chaetodon capistratus GN=cyp1a1 PE=2 SV=1 | 312 | 512 | 1.0E-10 |
| sp|P20814|CP2CD_RAT | Cytochrome P450 2C13, male-specific OS=Rattus norvegicus GN=Cyp2c13 PE=1 SV=1 | 314 | 507 | 1.0E-10 |
| sp|P33266|CP2E1_MACFA | Cytochrome P450 2E1 (Fragment) OS=Macaca fascicularis GN=CYP2E1 PE=2 SV=1 | 138 | 507 | 1.0E-10 |
| sp|Q64403|CP2DG_CAVPO | Cytochrome P450 2D16 OS=Cavia porcellus GN=CYP2D16 PE=1 SV=1 | 392 | 539 | 1.0E-10 |
| sp|O46054|C4AE1_DROME | Cytochrome P450 4ae1 OS=Drosophila melanogaster GN=Cyp4ae1 PE=2 SV=1 | 345 | 506 | 1.0E-10 |
| sp|Q05555|CP2AA_RABIT | Cytochrome P450 2A10 OS=Oryctolagus cuniculus GN=CYP2A10 PE=1 SV=1 | 344 | 506 | 1.0E-10 |
| sp|D5JBW9|GAO_SAUCO | Germacrene A oxidase OS=Saussurea costus PE=1 SV=1 | 373 | 517 | 1.0E-10 |
| sp|P51581|CP2E1_MESAU | Cytochrome P450 2E1 OS=Mesocricetus auratus GN=CYP2E1 PE=2 SV=1 | 210 | 507 | 1.0E-10 |
| sp|P56656|CP239_MOUSE | Cytochrome P450 2C39 OS=Mus musculus GN=Cyp2c39 PE=1 SV=2 | 210 | 507 | 1.0E-10 |
| sp|P00186|CP1A2_MOUSE | Cytochrome P450 1A2 OS=Mus musculus GN=Cyp1a2 PE=1 SV=1 | 62 | 511 | 1.0E-10 |
| sp|O93299|CP2K3_ONCMY | Cytochrome P450 2K3 OS=Oncorhynchus mykiss GN=cyp2k3 PE=2 SV=1 | 331 | 534 | 1.0E-10 |
| sp|Q91Z85|CP17A_PERLE | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Peromyscus leucopus GN=Cyp17a1 PE=3 SV=1 | 337 | 511 | 1.0E-10 |
| sp|D5JBX1|GAO_BARSP | Germacrene A oxidase OS=Barnadesia spinosa PE=1 SV=1 | 347 | 517 | 1.0E-10 |
| sp|O64637|C76C2_ARATH | Cytochrome P450 76C2 OS=Arabidopsis thaliana GN=CYP76C2 PE=2 SV=1 | 286 | 541 | 2.0E-10 |
| sp|Q05047|C72A1_CATRO | Secologanin synthase OS=Catharanthus roseus GN=CYP72A1 PE=2 SV=1 | 325 | 511 | 2.0E-10 |
| sp|O18963|CP2E1_BOVIN | Cytochrome P450 2E1 OS=Bos taurus GN=CYP2E1 PE=2 SV=1 | 210 | 539 | 2.0E-10 |
| sp|Q1ZXF5|C5084_DICDI | Probable cytochrome P450 508A4 OS=Dictyostelium discoideum GN=cyp508A4 PE=3 SV=1 | 347 | 512 | 2.0E-10 |
| sp|Q6Z5I7|C76M6_ORYSJ | Oryzalexin E synthase OS=Oryza sativa subsp. japonica GN=CYP76M6 PE=1 SV=1 | 344 | 536 | 2.0E-10 |
| sp|Q64429|CP1B1_MOUSE | Cytochrome P450 1B1 OS=Mus musculus GN=Cyp1b1 PE=1 SV=3 | 347 | 543 | 2.0E-10 |
| sp|Q42716|C71A8_MENPI | Cytochrome P450 71A8 OS=Mentha piperita GN=CYP71A8 PE=3 SV=1 | 320 | 508 | 2.0E-10 |
| sp|P33261|CP2CJ_HUMAN | Cytochrome P450 2C19 OS=Homo sapiens GN=CYP2C19 PE=1 SV=3 | 347 | 507 | 2.0E-10 |
| sp|Q27513|C13A4_CAEEL | Putative cytochrome P450 CYP13A4 OS=Caenorhabditis elegans GN=cyp-13A4 PE=3 SV=1 | 184 | 507 | 2.0E-10 |
| sp|H2DH17|C7A22_PANGI | Cytochrome P450 CYP749A22 OS=Panax ginseng PE=2 SV=1 | 181 | 510 | 2.0E-10 |
| sp|P56655|CP238_MOUSE | Cytochrome P450 2C38 OS=Mus musculus GN=Cyp2c38 PE=2 SV=2 | 210 | 529 | 2.0E-10 |
| sp|P37118|C71A2_SOLME | Cytochrome P450 71A2 OS=Solanum melongena GN=CYP71A2 PE=2 SV=1 | 347 | 527 | 2.0E-10 |
| sp|Q9VG82|CP9F2_DROME | Probable cytochrome P450 9f2 OS=Drosophila melanogaster GN=Cyp9f2 PE=2 SV=1 | 368 | 529 | 2.0E-10 |
| sp|Q82IY3|PTLI_STRAW | Pentalenene oxygenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ptlI PE=1 SV=1 | 274 | 513 | 2.0E-10 |
| sp|Q64583|CP2BF_RAT | Cytochrome P450 2B15 OS=Rattus norvegicus GN=Cyp2b15 PE=3 SV=2 | 95 | 505 | 2.0E-10 |
| sp|P24464|CP4AC_RAT | Cytochrome P450 4A12 OS=Rattus norvegicus GN=Cyp4a12 PE=2 SV=2 | 357 | 505 | 2.0E-10 |
| sp|P9WPP9|CP51_MYCTU | Lanosterol 14-alpha demethylase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp51 PE=1 SV=1 | 227 | 509 | 2.0E-10 |
| sp|P9WPP8|CP51_MYCTO | Lanosterol 14-alpha demethylase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp51 PE=3 SV=1 | 227 | 509 | 2.0E-10 |
| sp|P0A513|CP51_MYCBO | Lanosterol 14-alpha demethylase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp51 PE=3 SV=1 | 227 | 509 | 2.0E-10 |
| sp|Q6TBX7|LUT1_ARATH | Carotene epsilon-monooxygenase, chloroplastic OS=Arabidopsis thaliana GN=CYP97C1 PE=1 SV=1 | 200 | 512 | 2.0E-10 |
| sp|Q27712|CP2L1_PANAR | Cytochrome P450 2L1 OS=Panulirus argus GN=CYP2L1 PE=1 SV=1 | 347 | 512 | 2.0E-10 |
| sp|Q947B7|MFS_MENPI | (+)-menthofuran synthase OS=Mentha piperita PE=1 SV=1 | 344 | 517 | 2.0E-10 |
| sp|Q5TCH4|CP4AM_HUMAN | Cytochrome P450 4A22 OS=Homo sapiens GN=CYP4A22 PE=1 SV=1 | 320 | 506 | 2.0E-10 |
| sp|P05093|CP17A_HUMAN | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Homo sapiens GN=CYP17A1 PE=1 SV=1 | 197 | 507 | 2.0E-10 |
| sp|P48418|C75A1_PETHY | Flavonoid 3',5'-hydroxylase 1 OS=Petunia hybrida GN=CYP75A1 PE=2 SV=1 | 303 | 512 | 2.0E-10 |
| sp|Q9VGB4|CP132_DROME | Probable cytochrome P450 313a2 OS=Drosophila melanogaster GN=Cyp313a2 PE=3 SV=3 | 344 | 507 | 2.0E-10 |
| sp|O18809|CP2F3_CAPHI | Cytochrome P450 2F3 OS=Capra hircus GN=CYP2F3 PE=2 SV=1 | 95 | 539 | 2.0E-10 |
| sp|Q7KWN2|C525A_DICDI | Probable cytochrome P450 525A1 OS=Dictyostelium discoideum GN=cyp525A1 PE=3 SV=1 | 337 | 508 | 2.0E-10 |
| sp|O42231|CP1A1_LIZAU | Cytochrome P450 1A1 OS=Liza aurata GN=cyp1a1 PE=2 SV=1 | 325 | 512 | 3.0E-10 |
| sp|Q91WL5|CP4CA_MOUSE | Cytochrome P450 4A12A OS=Mus musculus GN=Cyp4a12a PE=1 SV=2 | 357 | 506 | 3.0E-10 |
| sp|P29981|CP4C1_BLADI | Cytochrome P450 4C1 OS=Blaberus discoidalis GN=CYP4C1 PE=2 SV=1 | 180 | 504 | 3.0E-10 |
| sp|Q9V674|CP6G1_DROME | Cytochrome P450 6g1 OS=Drosophila melanogaster GN=Cyp6g1 PE=2 SV=1 | 311 | 501 | 3.0E-10 |
| sp|O73853|CP17A_ICTPU | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Ictalurus punctatus GN=cyp17a1 PE=2 SV=1 | 347 | 512 | 3.0E-10 |
| sp|Q9V675|CP6G2_DROME | Probable cytochrome P450 6g2 OS=Drosophila melanogaster GN=Cyp6g2 PE=2 SV=1 | 191 | 501 | 3.0E-10 |
| sp|P33263|CP2CQ_MESAU | Cytochrome P450 2C26 OS=Mesocricetus auratus GN=CYP2C26 PE=2 SV=1 | 210 | 507 | 3.0E-10 |
| sp|Q8HYN1|CP17A_PANTR | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Pan troglodytes GN=CYP17A1 PE=2 SV=1 | 197 | 507 | 3.0E-10 |
| sp|Q64562|CP21A_RAT | Steroid 21-hydroxylase OS=Rattus norvegicus GN=Cyp21 PE=2 SV=1 | 184 | 550 | 3.0E-10 |
| sp|Q9V771|C6A23_DROME | Probable cytochrome P450 6a23 OS=Drosophila melanogaster GN=Cyp6a23 PE=2 SV=2 | 161 | 509 | 3.0E-10 |
| sp|Q43067|TCMO_PEA | Trans-cinnamate 4-monooxygenase OS=Pisum sativum GN=CYP73A9 PE=2 SV=2 | 273 | 524 | 3.0E-10 |
| sp|Q94FM7|C71DK_TOBAC | 5-epiaristolochene 1,3-dihydroxylase OS=Nicotiana tabacum GN=CYP71D20 PE=1 SV=2 | 389 | 511 | 3.0E-10 |
| sp|Q9VG17|CP304_DROME | Probable cytochrome P450 304a1 OS=Drosophila melanogaster GN=Cyp304a1 PE=2 SV=2 | 269 | 529 | 3.0E-10 |
| sp|P93531|C71D7_SOLCH | Cytochrome P450 71D7 OS=Solanum chacoense GN=CYP71D7 PE=3 SV=1 | 389 | 517 | 3.0E-10 |
| sp|Q9V4U7|C6A14_DROME | Probable cytochrome P450 6a14 OS=Drosophila melanogaster GN=Cyp6a14 PE=3 SV=2 | 324 | 538 | 3.0E-10 |
| sp|O42457|CP1A1_SPAAU | Cytochrome P450 1A1 OS=Sparus aurata GN=cyp1a1 PE=2 SV=1 | 325 | 512 | 3.0E-10 |
| sp|Q9SLP1|C78A9_ARATH | Cytochrome P450 78A9 OS=Arabidopsis thaliana GN=CYP78A9 PE=2 SV=1 | 344 | 517 | 3.0E-10 |
| sp|P00181|CP2C2_RABIT | Cytochrome P450 2C2 OS=Oryctolagus cuniculus GN=CYP2C2 PE=1 SV=2 | 285 | 504 | 4.0E-10 |
| sp|Q9LUC6|C7A14_ARATH | Cytochrome P450 72A14 OS=Arabidopsis thaliana GN=CYP72A14 PE=2 SV=1 | 343 | 511 | 4.0E-10 |
| sp|C0SPF7|C15C1_BOMMO | Farnesoate epoxidase OS=Bombyx mori GN=CYP15C1 PE=1 SV=2 | 347 | 512 | 4.0E-10 |
| sp|O81928|TCMO_CICAR | Trans-cinnamate 4-monooxygenase OS=Cicer arietinum GN=CYP73A19 PE=2 SV=2 | 287 | 524 | 4.0E-10 |
| sp|P33260|CP2CI_HUMAN | Cytochrome P450 2C18 OS=Homo sapiens GN=CYP2C18 PE=1 SV=3 | 347 | 507 | 4.0E-10 |
| sp|Q92113|CP17A_SQUAC | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Squalus acanthias GN=CYP17A1 PE=2 SV=1 | 347 | 549 | 4.0E-10 |
| sp|P58050|C71BD_ARATH | Cytochrome P450 71B13 OS=Arabidopsis thaliana GN=CYP71B13 PE=2 SV=1 | 328 | 536 | 4.0E-10 |
| sp|Q8HYM9|CP17A_MACMU | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Macaca mulatta GN=CYP17A1 PE=2 SV=1 | 197 | 507 | 4.0E-10 |
| sp|Q2XVA1|CP17A_MACFA | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Macaca fascicularis GN=CYP17A1 PE=2 SV=1 | 197 | 507 | 4.0E-10 |
| sp|Q27517|C13A3_CAEEL | Putative cytochrome P450 CYP13A3 OS=Caenorhabditis elegans GN=cyp-13A3 PE=3 SV=1 | 172 | 507 | 4.0E-10 |
| sp|Q6NKZ8|C14A2_ARATH | Cytochrome P450 714A2 OS=Arabidopsis thaliana GN=CYP714A2 PE=2 SV=1 | 336 | 510 | 4.0E-10 |
| sp|P24470|CP2CN_RAT | Cytochrome P450 2C23 OS=Rattus norvegicus GN=Cyp2c23 PE=2 SV=2 | 360 | 537 | 4.0E-10 |
| sp|B9G934|C14C3_ORYSJ | Cytochrome P450 714C3 OS=Oryza sativa subsp. japonica GN=CYP714C3 PE=3 SV=2 | 300 | 510 | 4.0E-10 |
| sp|Q9FG65|C81D1_ARATH | Cytochrome P450 81D1 OS=Arabidopsis thaliana GN=CYP81D1 PE=2 SV=1 | 336 | 507 | 5.0E-10 |
| sp|P05182|CP2E1_RAT | Cytochrome P450 2E1 OS=Rattus norvegicus GN=Cyp2e1 PE=1 SV=4 | 210 | 537 | 5.0E-10 |
| sp|Q92110|CP1A1_ONCMY | Cytochrome P450 1A1 OS=Oncorhynchus mykiss GN=cyp1a1 PE=2 SV=2 | 56 | 511 | 5.0E-10 |
| sp|O55127|CP26A_MOUSE | Cytochrome P450 26A1 OS=Mus musculus GN=Cyp26a1 PE=2 SV=1 | 344 | 511 | 5.0E-10 |
| sp|Q91X77|CY250_MOUSE | Cytochrome P450 2C50 OS=Mus musculus GN=Cyp2c50 PE=1 SV=2 | 95 | 507 | 5.0E-10 |
| sp|Q54E98|C520B_DICDI | Putative cytochrome P450 520B1 OS=Dictyostelium discoideum GN=cyp520B1 PE=5 SV=1 | 221 | 534 | 5.0E-10 |
| sp|Q9VE01|C12A5_DROME | Probable cytochrome P450 12a5, mitochondrial OS=Drosophila melanogaster GN=Cyp12a5 PE=2 SV=1 | 272 | 508 | 5.0E-10 |
| sp|Q27593|CP6A8_DROME | Cytochrome P450 6a8 OS=Drosophila melanogaster GN=Cyp6a8 PE=2 SV=2 | 175 | 506 | 5.0E-10 |
| sp|P79716|CP1A1_DICLA | Cytochrome P450 1A1 OS=Dicentrarchus labrax GN=cyp1a1 PE=2 SV=1 | 311 | 512 | 5.0E-10 |
| sp|O48927|C78A3_SOYBN | Cytochrome P450 78A3 OS=Glycine max GN=CYP78A3 PE=2 SV=1 | 183 | 517 | 5.0E-10 |
| sp|Q9LTM0|C71BN_ARATH | Cytochrome P450 71B23 OS=Arabidopsis thaliana GN=CYP71B23 PE=2 SV=1 | 326 | 517 | 5.0E-10 |
| sp|O62671|CP241_CANLF | Cytochrome P450 2C41 OS=Canis lupus familiaris GN=CYP2C41 PE=2 SV=1 | 314 | 504 | 6.0E-10 |
| sp|Q9VFJ0|CA131_DROME | Probable cytochrome P450 313a1 OS=Drosophila melanogaster GN=Cyp313a1 PE=3 SV=2 | 337 | 504 | 6.0E-10 |
| sp|Q2LA59|CP21A_LYNLY | Steroid 21-hydroxylase OS=Lynx lynx GN=CYP21 PE=3 SV=1 | 184 | 506 | 6.0E-10 |
| sp|O44221|CP4E5_DROMT | Cytochrome P450 4e5, mitochondrial OS=Drosophila mettleri GN=Cyp4e5 PE=2 SV=1 | 127 | 571 | 6.0E-10 |
| sp|P04167|CP2B2_RAT | Cytochrome P450 2B2 OS=Rattus norvegicus GN=Cyp2b2 PE=1 SV=2 | 122 | 514 | 6.0E-10 |
| sp|O22307|C71DB_LOTJA | Cytochrome P450 71D11 (Fragment) OS=Lotus japonicus GN=CYP71D11 PE=2 SV=1 | 375 | 538 | 6.0E-10 |
| sp|P19225|CP270_RAT | Cytochrome P450 2C70 OS=Rattus norvegicus GN=Cyp2c70 PE=2 SV=1 | 210 | 507 | 7.0E-10 |
| sp|O81974|C71D8_SOYBN | Cytochrome P450 71D8 OS=Glycine max GN=CYP71D8 PE=2 SV=1 | 389 | 508 | 7.0E-10 |
| sp|Q8LIF2|C7345_ORYSJ | Cytochrome P450 734A5 OS=Oryza sativa subsp. japonica GN=CYP734A5 PE=2 SV=1 | 158 | 511 | 7.0E-10 |
| sp|Q9LW27|C71BF_ARATH | Bifunctional dihydrocamalexate synthase/camalexin synthase OS=Arabidopsis thaliana GN=CYP71B15 PE=1 SV=1 | 344 | 517 | 7.0E-10 |
| sp|Q55BU9|C5133_DICDI | Probable cytochrome P450 513A3 OS=Dictyostelium discoideum GN=cyp513A3 PE=3 SV=1 | 120 | 506 | 7.0E-10 |
| sp|Q64462|CP4B1_MOUSE | Cytochrome P450 4B1 OS=Mus musculus GN=Cyp4b1 PE=1 SV=1 | 298 | 512 | 7.0E-10 |
| sp|H1A988|C7254_GLYUR | 11-oxo-beta-amyrin 30-oxidase OS=Glycyrrhiza uralensis GN=CYP72A154 PE=1 SV=1 | 337 | 510 | 7.0E-10 |
| sp|P93149|C93B1_GLYEC | Licodione synthase OS=Glycyrrhiza echinata GN=CYP93B1 PE=1 SV=2 | 347 | 506 | 8.0E-10 |
| sp|Q9HCS2|CP4FC_HUMAN | Cytochrome P450 4F12 OS=Homo sapiens GN=CYP4F12 PE=1 SV=2 | 345 | 506 | 8.0E-10 |
| sp|Q64458|CP2CT_MOUSE | Cytochrome P450 2C29 OS=Mus musculus GN=Cyp2c29 PE=1 SV=2 | 210 | 534 | 8.0E-10 |
| sp|Q08078|CP2CP_MESAU | Cytochrome P450 2C25 OS=Mesocricetus auratus GN=CYP2C25 PE=2 SV=1 | 210 | 507 | 9.0E-10 |
| sp|B9GBJ9|C14C1_ORYSJ | Cytochrome P450 714C1 OS=Oryza sativa subsp. japonica GN=CYP714C1 PE=2 SV=1 | 300 | 510 | 9.0E-10 |
| sp|H2DH18|C7A12_PANGI | Cytochrome P450 CYP736A12 OS=Panax ginseng PE=2 SV=1 | 344 | 529 | 9.0E-10 |
| sp|P30608|CP52F_CANTR | Cytochrome P450 52A6 OS=Candida tropicalis GN=CYP52A6 PE=2 SV=1 | 188 | 510 | 9.0E-10 |
| sp|P51871|CP4F6_RAT | Cytochrome P450 4F6 OS=Rattus norvegicus GN=Cyp4f6 PE=2 SV=1 | 345 | 504 | 9.0E-10 |
| sp|Q43033|TCMO_PETCR | Trans-cinnamate 4-monooxygenase OS=Petroselinum crispum GN=CYP73A10 PE=2 SV=1 | 286 | 524 | 9.0E-10 |
| sp|Q43068|C82A1_PEA | Cytochrome P450 82A1 (Fragment) OS=Pisum sativum GN=CYP82A1 PE=2 SV=2 | 344 | 537 | 1.0E-09 |
| sp|Q9VWR5|CP306_DROME | Cytochrome P450 306a1 OS=Drosophila melanogaster GN=phm PE=1 SV=1 | 347 | 534 | 1.0E-09 |
| sp|Q9LVD2|C71BA_ARATH | Cytochrome P450 71B10 OS=Arabidopsis thaliana GN=CYP71B10 PE=3 SV=1 | 176 | 527 | 1.0E-09 |
| sp|Q27515|C13A6_CAEEL | Putative cytochrome P450 CYP13A6 OS=Caenorhabditis elegans GN=cyp-13A6 PE=3 SV=1 | 184 | 544 | 1.0E-09 |
| sp|Q9LUC9|C7A11_ARATH | Cytochrome P450 72A11 OS=Arabidopsis thaliana GN=CYP72A11 PE=2 SV=1 | 343 | 511 | 1.0E-09 |
| sp|O64636|C76C1_ARATH | Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CYP76C1 PE=2 SV=1 | 347 | 541 | 1.0E-09 |
| sp|Q7XHW5|C14B1_ORYSJ | Cytochrome P450 714B1 OS=Oryza sativa subsp. japonica GN=CYP714B1 PE=1 SV=2 | 335 | 510 | 1.0E-09 |
| sp|Q8TAV3|CP2W1_HUMAN | Cytochrome P450 2W1 OS=Homo sapiens GN=CYP2W1 PE=1 SV=2 | 210 | 529 | 1.0E-09 |
| sp|O49342|C71AD_ARATH | Indoleacetaldoxime dehydratase OS=Arabidopsis thaliana GN=CYP71A13 PE=1 SV=1 | 323 | 514 | 1.0E-09 |
| sp|O04164|C71A6_NEPRA | Cytochrome P450 71A6 (Fragment) OS=Nepeta racemosa GN=CYP71A6 PE=2 SV=1 | 344 | 536 | 1.0E-09 |
| sp|B9DFU2|MAX1_ARATH | Cytochrome P450 711A1 OS=Arabidopsis thaliana GN=CYP711A1 PE=2 SV=1 | 345 | 506 | 1.0E-09 |
| sp|Q08477|CP4F3_HUMAN | Docosahexaenoic acid omega-hydroxylase CYP4F3 OS=Homo sapiens GN=CYP4F3 PE=1 SV=2 | 345 | 504 | 1.0E-09 |
| sp|P51869|CP4F4_RAT | Cytochrome P450 4F4 OS=Rattus norvegicus GN=Cyp4f4 PE=2 SV=1 | 345 | 504 | 1.0E-09 |
| sp|P12791|CP2BA_MOUSE | Cytochrome P450 2B10 OS=Mus musculus GN=Cyp2b10 PE=1 SV=1 | 120 | 514 | 1.0E-09 |
| sp|Q8HYN0|CP17A_PAPCY | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Papio cynocephalus GN=CYP17A1 PE=2 SV=1 | 197 | 507 | 1.0E-09 |
| sp|Q6JZS3|CP1A1_ORYLA | Cytochrome P450 1A1 OS=Oryzias latipes GN=cyp1a1 PE=3 SV=1 | 229 | 512 | 1.0E-09 |
| sp|Q2PG45|THAS_MACFA | Thromboxane-A synthase OS=Macaca fascicularis GN=TBXAS1 PE=2 SV=2 | 337 | 510 | 1.0E-09 |
| sp|P20678|CP2H2_CHICK | Cytochrome P450 2H2 OS=Gallus gallus GN=CYP2H2 PE=1 SV=1 | 109 | 517 | 2.0E-09 |
| sp|F8S1H3|C7BL1_HELAN | Cytochrome P450 71BL1 OS=Helianthus annuus GN=CYP71BL1 PE=2 SV=1 | 363 | 536 | 2.0E-09 |
| sp|H2DH21|C7A29_PANGI | Cytochrome P450 CYP72A219 OS=Panax ginseng PE=2 SV=1 | 84 | 511 | 2.0E-09 |
| sp|Q64678|CP1B1_RAT | Cytochrome P450 1B1 OS=Rattus norvegicus GN=Cyp1b1 PE=1 SV=1 | 347 | 519 | 2.0E-09 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0004497 | monooxygenase activity | Yes |
| GO:0016705 | oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen | Yes |
| GO:0005506 | iron ion binding | Yes |
| GO:0020037 | heme binding | Yes |
| GO:0016491 | oxidoreductase activity | No |
| GO:0046906 | tetrapyrrole binding | No |
| GO:0003824 | catalytic activity | No |
| GO:0046872 | metal ion binding | No |
| GO:0046914 | transition metal ion binding | No |
| GO:0097159 | organic cyclic compound binding | No |
| GO:0005488 | binding | No |
| GO:0043167 | ion binding | No |
| GO:1901363 | heterocyclic compound binding | No |
| GO:0043169 | cation binding | No |
| GO:0003674 | molecular_function | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 28 | 0.45 |
| Domain # | Start | End | Length |
|---|---|---|---|
| 1 | 5 | 27 | 22 |
| 2 | 62 | 84 | 22 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Hirsu2|5191 MLHQAYGQLLLAAAAGLAAHGCYFVRGEHDLAAARIARLHLAAAALVAGLKWQCQGLALRHALAAAVALAAAYAA ALFASILVFRLFLSPLRRMPGPLRLRCTKLTHMWDMACRRNCELLHELHREYGDVVRTGPNEVAVFGLDAYRQIH GPESRCGRAAYYDIVHPMVSLDTTRDDSVHAHRRKLWDQAFSIKSLEQAEPIIASCAGELAKQLRQREGQPLDMS VWLEHYTFDVMGLFGLTIDFRNLADGEHPLLALFHMAHRLLGPLAAVPWLKHLLMGIPFVERMKYYREFFTWADL ELHKNIGQNQHERRNIIGYVLADAERNGGIEANWNFVLGDFVLVIIAGSDPVRQVLVNMLFYLTQHPEHLHLLRQ ELASPGGRTQHRLLQGLPHLNAVVYETLRLNPAVPSAGLRLPPRGGVAVNGVWIPENTTIVTPQYSLMRDERYFD RPEEWIPERFTTRPELILNKDAFVPWSIGRRSCIGKNLSLMEIRVAAALLLTEFDFEFAPGEDGTDMFARATDYF TTTPGPLRLIPRIRKRPESEQDRGEDLTAKVPACTTTLHVEKQEKGFEDELQPEEQELKKVSNVMSDF* |
| Coding | >Hirsu2|5191 ATGCTCCACCAAGCCTACGGCCAGCTCCTCCTCGCCGCCGCCGCCGGCCTGGCCGCCCACGGCTGCTACTTCGTC CGCGGCGAGCACGACCTTGCCGCCGCCCGCATCGCCCGCCTCCATCTCGCCGCCGCCGCCCTGGTCGCCGGTCTC AAGTGGCAGTGCCAGGGCCTCGCGCTGCGGCACGCCCTCGCCGCCGCCGTCGCCCTCGCCGCCGCCTACGCCGCC GCCCTCTTCGCCAGCATCCTCGTCTTCCGCCTGTTCCTCTCGCCCCTGCGGCGGATGCCGGGCCCGTTGCGGCTG CGGTGCACCAAGCTGACGCACATGTGGGACATGGCCTGCCGGCGGAACTGCGAGCTTCTGCACGAGCTCCATCGC GAGTACGGCGACGTGGTGAGGACCGGGCCCAACGAAGTCGCCGTCTTCGGCCTCGATGCCTACCGCCAGATCCAT GGCCCCGAGTCGCGCTGCGGACGGGCGGCCTACTACGACATTGTCCATCCCATGGTGTCTCTGGACACGACCCGC GACGACAGCGTACACGCCCACCGACGAAAGCTCTGGGACCAGGCCTTTAGCATCAAGTCCCTCGAACAGGCCGAG CCCATAATAGCCTCCTGCGCAGGAGAGCTCGCCAAGCAGCTGCGGCAGCGCGAGGGCCAGCCCCTCGACATGTCC GTCTGGCTCGAGCACTACACCTTCGACGTCATGGGCCTGTTCGGCCTGACCATCGACTTCCGCAACCTCGCCGAC GGCGAGCATCCCCTCCTGGCCCTCTTCCACATGGCCCACCGCCTGCTGGGGCCGCTGGCGGCCGTGCCGTGGCTG AAGCACCTCCTGATGGGCATCCCCTTCGTCGAGCGGATGAAGTACTACCGCGAATTCTTTACCTGGGCCGACCTT GAGCTCCACAAGAACATCGGGCAGAACCAGCATGAGCGCCGCAACATCATCGGCTATGTCCTGGCCGACGCAGAG AGGAATGGCGGCATCGAAGCCAACTGGAACTTTGTCCTCGGCGACTTCGTCCTCGTCATCATCGCGGGGAGCGAC CCCGTCCGCCAGGTCTTGGTCAACATGCTGTTCTATCTCACCCAGCACCCGGAGCACCTCCATCTTCTCAGGCAG GAGCTCGCCTCGCCCGGCGGCCGCACCCAGCATAGGCTGTTGCAGGGCCTGCCGCACCTGAACGCCGTCGTCTAC GAGACGCTGCGGCTAAATCCCGCCGTGCCCTCGGCCGGCCTCAGACTGCCGCCGCGCGGGGGTGTGGCAGTCAAC GGTGTCTGGATCCCCGAAAACACCACCATCGTGACGCCGCAGTACAGTCTGATGCGAGATGAGCGGTACTTCGAC AGGCCCGAGGAATGGATCCCCGAGCGCTTCACCACCCGGCCGGAGCTCATCCTGAACAAGGACGCGTTTGTGCCG TGGTCGATAGGCAGGAGATCTTGTATAGGTAAGAACTTGAGCTTAATGGAGATCCGCGTGGCGGCAGCGCTGCTC CTCACCGAGTTCGACTTCGAATTCGCCCCAGGCGAGGACGGGACCGATATGTTCGCGCGGGCGACCGACTACTTC ACGACCACTCCCGGGCCGCTCCGGCTGATACCCAGGATCCGAAAGAGACCCGAGTCGGAGCAGGACCGGGGCGAG GATTTGACGGCGAAAGTTCCGGCCTGCACGACGACGCTACACGTGGAAAAACAGGAAAAAGGATTTGAAGATGAA TTACAGCCCGAAGAACAAGAATTGAAGAAAGTGTCAAATGTAATGTCCGATTTTTGA |
| Transcript | >Hirsu2|5191 ATGCTCCACCAAGCCTACGGCCAGCTCCTCCTCGCCGCCGCCGCCGGCCTGGCCGCCCACGGCTGCTACTTCGTC CGCGGCGAGCACGACCTTGCCGCCGCCCGCATCGCCCGCCTCCATCTCGCCGCCGCCGCCCTGGTCGCCGGTCTC AAGTGGCAGTGCCAGGGCCTCGCGCTGCGGCACGCCCTCGCCGCCGCCGTCGCCCTCGCCGCCGCCTACGCCGCC GCCCTCTTCGCCAGCATCCTCGTCTTCCGCCTGTTCCTCTCGCCCCTGCGGCGGATGCCGGGCCCGTTGCGGCTG CGGTGCACCAAGCTGACGCACATGTGGGACATGGCCTGCCGGCGGAACTGCGAGCTTCTGCACGAGCTCCATCGC GAGTACGGCGACGTGGTGAGGACCGGGCCCAACGAAGTCGCCGTCTTCGGCCTCGATGCCTACCGCCAGATCCAT GGCCCCGAGTCGCGCTGCGGACGGGCGGCCTACTACGACATTGTCCATCCCATGGTGTCTCTGGACACGACCCGC GACGACAGCGTACACGCCCACCGACGAAAGCTCTGGGACCAGGCCTTTAGCATCAAGTCCCTCGAACAGGCCGAG CCCATAATAGCCTCCTGCGCAGGAGAGCTCGCCAAGCAGCTGCGGCAGCGCGAGGGCCAGCCCCTCGACATGTCC GTCTGGCTCGAGCACTACACCTTCGACGTCATGGGCCTGTTCGGCCTGACCATCGACTTCCGCAACCTCGCCGAC GGCGAGCATCCCCTCCTGGCCCTCTTCCACATGGCCCACCGCCTGCTGGGGCCGCTGGCGGCCGTGCCGTGGCTG AAGCACCTCCTGATGGGCATCCCCTTCGTCGAGCGGATGAAGTACTACCGCGAATTCTTTACCTGGGCCGACCTT GAGCTCCACAAGAACATCGGGCAGAACCAGCATGAGCGCCGCAACATCATCGGCTATGTCCTGGCCGACGCAGAG AGGAATGGCGGCATCGAAGCCAACTGGAACTTTGTCCTCGGCGACTTCGTCCTCGTCATCATCGCGGGGAGCGAC CCCGTCCGCCAGGTCTTGGTCAACATGCTGTTCTATCTCACCCAGCACCCGGAGCACCTCCATCTTCTCAGGCAG GAGCTCGCCTCGCCCGGCGGCCGCACCCAGCATAGGCTGTTGCAGGGCCTGCCGCACCTGAACGCCGTCGTCTAC GAGACGCTGCGGCTAAATCCCGCCGTGCCCTCGGCCGGCCTCAGACTGCCGCCGCGCGGGGGTGTGGCAGTCAAC GGTGTCTGGATCCCCGAAAACACCACCATCGTGACGCCGCAGTACAGTCTGATGCGAGATGAGCGGTACTTCGAC AGGCCCGAGGAATGGATCCCCGAGCGCTTCACCACCCGGCCGGAGCTCATCCTGAACAAGGACGCGTTTGTGCCG TGGTCGATAGGCAGGAGATCTTGTATAGGTAAGAACTTGAGCTTAATGGAGATCCGCGTGGCGGCAGCGCTGCTC CTCACCGAGTTCGACTTCGAATTCGCCCCAGGCGAGGACGGGACCGATATGTTCGCGCGGGCGACCGACTACTTC ACGACCACTCCCGGGCCGCTCCGGCTGATACCCAGGATCCGAAAGAGACCCGAGTCGGAGCAGGACCGGGGCGAG GATTTGACGGCGAAAGTTCCGGCCTGCACGACGACGCTACACGTGGAAAAACAGGAAAAAGGATTTGAAGATGAA TTACAGCCCGAAGAACAAGAATTGAAGAAAGTGTCAAATGTAATGTCCGATTTTTGA |
| Gene | >Hirsu2|5191 ATGCTCCACCAAGCCTACGGCCAGCTCCTCCTCGCCGCCGCCGCCGGCCTGGCCGCCCACGGCTGCTACTTCGTC CGCGGCGAGCACGACCTTGCCGCCGCCCGCATCGCCCGCCTCCATCTCGCCGCCGCCGCCCTGGTCGCCGGTCTC AAGTGGCAGTGCCAGGGCCTCGCGCTGCGGCACGCCCTCGCCGCCGCCGTCGCCCTCGCCGCCGCCTACGCCGCC GCCCTCTTCGCCAGCATCCTCGTCTTCCGCCTGTTCCTCTCGCCCCTGCGGCGGATGCCGGGCCCGTTGCGGCTG CGGTGCACCAAGCTGACGCACATGTGGGACATGGCCTGCCGGCGGAACTGCGAGCTTCTGCACGAGCTCCATCGC GAGTACGGCGACGTGGTGAGGACCGGTTCGTCTTCGATCGCGGCCCTCCCTCGTCCGCCTGGCCGGACGCTTCGT CGTGTGCTGCCAGTCATGGACGGCTAAGCCGCATCTCTCGCAACAGGGCCCAACGAAGTCGCCGTCTTCGGCCTC GATGCCTACCGCCAGATCCATGGCCCCGAGTCGCGCTGCGGACGGGCGGCCTACTACGACATTGTCCATCCCATG GTGTCTCTGGACACGACCCGCGACGACAGCGTACACGCCCACCGACGAAAGCTCTGGGACCAGGCCTTTAGCATC AAGTGTAGGTCTTGATGACCGCCTCCGGTCCGGTTCGCATCCTGTCTGACCTTACTCGATATGGCCGCACAGCCC TCGAACAGGCCGAGCCCATAATAGCCTCCTGCGCAGGAGAGCTCGCCAAGCAGCTGCGGCAGCGCGAGGGCCAGC CCCTCGACATGTCCGTCTGGCTCGAGCACTACACCTTCGACGTCATGGGCCTGTTCGGCCTGACCATCGACTTCC GCAACCTCGCCGACGGCGAGCATCCCCTCCTGGCCCTCTTCCACATGGCCCACCGCCTGCTGGGGCCGCTGGCGG CCGTGCCGTGGCTGAAGCACCTCCTGATGGGCATCCCCTTCGTCGAGCGGATGAAGTACTACCGCGAATTCTTTA CCTGGGCCGACCTTGAGCTCCACAAGAACATCGGGCAGAACCAGCATGAGCGCCGCAACATCATCGGCTATGTCC TGGCCGACGCAGAGAGGAATGGCGGCATCGAAGCCAACTGGAACTTTGTCCTCGGCGACTTCGTCCTCGTCATCA TCGCGGGGAGCGACCCCGTCCGCCAGGTCTTGGTCAACATGCTGTTCTATCTCACCCAGCACCCGGAGCACCTCC ATCTTCTCAGGCAGGAGCTCGCCTCGCCCGGCGGCCGCACCCAGCATAGGCTGTTGCAGGGCCTGCCGCACCTGA ACGCCGTCGTCTACGAGACGCTGCGGCTAAATCCCGCCGTGCCCTCGGCCGGCCTCAGACTGCCGCCGCGCGGGG GTGTGGCAGTCAACGGTGTCTGGATCCCCGAAAACACCACCATCGTGACGCCGCAGTACAGTCTGATGCGAGGTT GATCCCTCTCTCGTTCTCAAGCGCCCCCTCCCCCCCCGATCTCGCGTCGTCGAGTTGAAGGCCCTCTGATATGGT TCACTGACGAGATGCGCGCAGATGAGCGGTACTTCGACAGGCCCGAGGAATGGATCCCCGAGCGCTTCACCACCC GGCCGGAGCTCATCCTGAACAAGGACGCGTTTGTGCCGTGGTCGATAGGTGAGCTCCGAATCTTGCCATGGCACC CCATCTCGTTGTTCAAATCCGTGTCTTGCTCATCCACGTCTGCAGGCAGGAGATCTTGTATAGGTAAGAACTTGA GCTTAATGGAGATCCGCGTGGCGGCAGCGCTGCTCCTCACCGAGTTCGACTTCGAATTCGCCCCAGGCGAGGACG GGACCGATATGTTCGCGCGGGCGACCGACTACTTCACGACCACTCCCGGGCCGCTCCGGCTGATACCCAGGATCC GAAAGAGACCCGAGTCGGAGCAGGACCGGGGCGAGGATTTGACGGCGAAAGTTCCGGCCTGCACGACGACGCTAC ACGTGGAAAAACAGGAAAAAGGATTTGAAGATGAATTACAGCCCGAAGAACAAGAATTGAAGAAAGTGTCAAATG TAATGTCCGATTTTTGA |