Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5181
Gene name
LocationContig_2595:199..2051
Strand-
Gene length (bp)1852
Transcript length (bp)1029
Coding sequence length (bp)1029
Protein length (aa) 343

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09729 Gti1_Pac2 Gti1/Pac2 family 8.3E-37 166 247
PF09729 Gti1_Pac2 Gti1/Pac2 family 3.8E-05 279 309

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10294|PAC2_SCHPO cAMP-independent regulatory protein pac2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pac2 PE=2 SV=1 164 340 2.0E-64
sp|W7MPI5|WOR1_GIBM7 Global transcription regulator sge1 OS=Gibberella moniliformis (strain M3125 / FGSC 7600) GN=sge1 PE=3 SV=1 166 332 1.0E-27
sp|S0E3H0|WOR1_GIBF5 Global transcription regulator sge1 OS=Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831) GN=sge1 PE=2 SV=1 166 332 2.0E-27
sp|J9N5P9|WOR1_FUSO4 Global transcription regulator sge1 OS=Fusarium oxysporum f. sp. lycopersici (strain 4287 / CBS 123668 / FGSC 9935 / NRRL 34936) GN=sge1 PE=2 SV=1 166 332 7.0E-25
sp|I1S5P3|WOR1_GIBZE Global transcription regulator FGP1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=FGP1 PE=3 SV=1 166 309 2.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10294|PAC2_SCHPO cAMP-independent regulatory protein pac2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pac2 PE=2 SV=1 164 340 2.0E-64
sp|W7MPI5|WOR1_GIBM7 Global transcription regulator sge1 OS=Gibberella moniliformis (strain M3125 / FGSC 7600) GN=sge1 PE=3 SV=1 166 332 1.0E-27
sp|S0E3H0|WOR1_GIBF5 Global transcription regulator sge1 OS=Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831) GN=sge1 PE=2 SV=1 166 332 2.0E-27
sp|J9N5P9|WOR1_FUSO4 Global transcription regulator sge1 OS=Fusarium oxysporum f. sp. lycopersici (strain 4287 / CBS 123668 / FGSC 9935 / NRRL 34936) GN=sge1 PE=2 SV=1 166 332 7.0E-25
sp|I1S5P3|WOR1_GIBZE Global transcription regulator FGP1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=FGP1 PE=3 SV=1 166 309 2.0E-21
sp|O14367|GTI1_SCHPO Gluconate transport inducer 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gti1 PE=4 SV=1 159 247 3.0E-20
sp|G2X740|WOR1_VERDV Global transcription regulator sge1 OS=Verticillium dahliae (strain VdLs.17 / ATCC MYA-4575 / FGSC 10137) GN=sge1 PE=3 SV=1 166 332 2.0E-19
sp|P38867|YHX7_YEAST Uncharacterized protein YHR177W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHR177W PE=1 SV=2 162 332 1.0E-17
sp|P40002|MIT1_YEAST Transcriptional regulator MIT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIT1 PE=1 SV=1 162 332 2.0E-17
sp|Q5AP80|WOR1_CANAL White-opaque regulator 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=WOR1 PE=1 SV=1 166 243 6.0E-14
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5181
LLLFLPLLCLAAASSSAAAASSAASASASFSSGLASAAAADSLLNAIAAPLAAAILLRDGLVRLRHRPSRRATLA
PPLASSPHAALRLLLCLVSVLLAESTSRVSSRRRCRHSEATHPLSTGGLKCWEPCRLEPIVSSPASATANRPASA
GTANPPSETDPDRMETYHGYVRTPGDAIKLFEACRLGLLPRVQRRLSEKERQSIRSGSVFVWDEREAGMRRWTDG
KSWSASRVSGSFLTYREMEGKRGGGFGSGRRGAGKTPDSGRGSDEDHDDGEPEGYRYKADGLMKQSFSITTSTNQ
HLHLISYYSRPQPGQPDLNQPSSDPSLRGIVPPKGMYPDSRT*
Coding >Hirsu2|5181
CTGCTCCTATTCCTGCCGCTCCTCTGCCTCGCCGCCGCCTCCTCCTCCGCCGCCGCCGCCTCCTCCGCCGCCTCC
GCCTCCGCCAGCTTCTCCTCCGGCCTCGCCTCAGCAGCAGCGGCAGACTCGCTCCTCAACGCCATCGCCGCCCCC
CTCGCCGCCGCCATCCTCCTCCGCGACGGCCTCGTCCGCCTCCGCCACCGACCGAGCCGACGAGCCACCCTCGCG
CCGCCTCTGGCCTCGAGCCCTCACGCCGCTCTTCGACTCCTGCTCTGCCTCGTCAGTGTCCTCCTGGCCGAGTCT
ACCTCACGAGTCTCCTCCCGCCGCAGGTGCCGCCATAGTGAGGCCACGCACCCCTTGTCCACCGGGGGGCTCAAG
TGTTGGGAGCCCTGCCGACTGGAGCCCATCGTCTCATCGCCTGCCAGCGCCACGGCAAATCGTCCTGCGTCCGCA
GGCACGGCCAATCCACCGTCTGAAACGGACCCGGACAGGATGGAGACGTACCACGGCTACGTGCGCACCCCCGGC
GACGCCATCAAGCTGTTCGAGGCCTGCCGCCTGGGCCTGCTGCCGCGCGTCCAGCGCCGGCTGTCGGAGAAGGAG
CGGCAGTCGATCCGCTCCGGCTCCGTCTTCGTCTGGGACGAGCGCGAGGCCGGCATGCGGAGGTGGACCGACGGC
AAGTCGTGGAGCGCCAGCCGCGTCTCCGGCAGCTTCCTGACCTACCGCGAGATGGAGGGCAAGCGCGGCGGCGGC
TTCGGCAGCGGCCGGAGGGGCGCCGGCAAGACGCCCGACTCGGGCCGCGGCAGCGACGAGGACCACGACGACGGC
GAGCCCGAGGGCTACCGCTACAAGGCCGACGGCCTGATGAAGCAGTCGTTCAGCATCACCACCTCGACCAACCAG
CACCTGCACCTCATCTCCTACTACTCGCGCCCCCAGCCGGGCCAGCCCGACCTCAACCAGCCGAGCTCCGACCCG
TCCCTGCGCGGCATCGTCCCGCCCAAGGGCATGTACCCCGACAGCCGTACATGA
Transcript >Hirsu2|5181
CTGCTCCTATTCCTGCCGCTCCTCTGCCTCGCCGCCGCCTCCTCCTCCGCCGCCGCCGCCTCCTCCGCCGCCTCC
GCCTCCGCCAGCTTCTCCTCCGGCCTCGCCTCAGCAGCAGCGGCAGACTCGCTCCTCAACGCCATCGCCGCCCCC
CTCGCCGCCGCCATCCTCCTCCGCGACGGCCTCGTCCGCCTCCGCCACCGACCGAGCCGACGAGCCACCCTCGCG
CCGCCTCTGGCCTCGAGCCCTCACGCCGCTCTTCGACTCCTGCTCTGCCTCGTCAGTGTCCTCCTGGCCGAGTCT
ACCTCACGAGTCTCCTCCCGCCGCAGGTGCCGCCATAGTGAGGCCACGCACCCCTTGTCCACCGGGGGGCTCAAG
TGTTGGGAGCCCTGCCGACTGGAGCCCATCGTCTCATCGCCTGCCAGCGCCACGGCAAATCGTCCTGCGTCCGCA
GGCACGGCCAATCCACCGTCTGAAACGGACCCGGACAGGATGGAGACGTACCACGGCTACGTGCGCACCCCCGGC
GACGCCATCAAGCTGTTCGAGGCCTGCCGCCTGGGCCTGCTGCCGCGCGTCCAGCGCCGGCTGTCGGAGAAGGAG
CGGCAGTCGATCCGCTCCGGCTCCGTCTTCGTCTGGGACGAGCGCGAGGCCGGCATGCGGAGGTGGACCGACGGC
AAGTCGTGGAGCGCCAGCCGCGTCTCCGGCAGCTTCCTGACCTACCGCGAGATGGAGGGCAAGCGCGGCGGCGGC
TTCGGCAGCGGCCGGAGGGGCGCCGGCAAGACGCCCGACTCGGGCCGCGGCAGCGACGAGGACCACGACGACGGC
GAGCCCGAGGGCTACCGCTACAAGGCCGACGGCCTGATGAAGCAGTCGTTCAGCATCACCACCTCGACCAACCAG
CACCTGCACCTCATCTCCTACTACTCGCGCCCCCAGCCGGGCCAGCCCGACCTCAACCAGCCGAGCTCCGACCCG
TCCCTGCGCGGCATCGTCCCGCCCAAGGGCATGTACCCCGACAGCCGTACATGA
Gene >Hirsu2|5181
CTGCTCCTATTCCTGCCGCTCCTCTGCCTCGCCGCCGCCTCCTCCTCCGCCGCCGCCGCCTCCTCCGCCGCCTCC
GCCTCCGCCAGCTTCTCCTCCGGCCTCGCCTCAGCAGCAGCGGCAGACTCGCTCCTCAACGCCATCGCCGCCCCC
CTCGCCGCCGCCATCCTCCTCCGCGACGGCCTCGTCCGCCTCCGCCACCGACCGAGCCGACGAGCCACCCTCGCG
CCGCCTCTGGCCTCGAGCCCTCACGCCGCTCTTCGACTCCTGCTCTGCCTCGTCAGGTAAGGCTCCCTCGCCGAA
ACGCCCTGCCACGATGCACAACAACCACAAGAGAGGCGCACGTCGTCTAGCTTTCCACACATGGCTCCCGCCGTT
CCTGTCGCTTCCCGCCGCTCCTGGCCACAAGGGCCCTCTCGTCGGCTTCCCTGCCCAAGCCGCCGCCAGTGCGAG
CGCGCGCAACCGTCACCCAGCCCTCGCCTAATCCTGTCTCCCGACTCCTCCTGCCTCTCTCCTCCGCCTCTTCTC
CCTCTCATCTCTCCTCCACCTCTGCTCGTGACCACCTCGCCTCACCACCGCTGTCCTCCTCGTCTCAAGTCCCGT
CATGCACTTCGCCGAGCGGCGACACGGCACGGCACGGCACTTCGACTCGAGCCGAGCCTGTCCGTCGCGCTGGAA
CCTGCTGTGTCCGCTTGTGCCTGAGCCGACTGGCCACGCAAACCGCCGTGTTTGCGCCCGGCCAGCGCCCACGCG
CCGCTGCCCGGTGAAATCCCGTCTTCGCGCCTTGTGCTCGCCAGTCGTGCACGCGCTTGCCTGCCTTGGATGCTA
CCCCAGACGCACTCACGCACCCACACCCACCCACACACAAAGGGGGAGAGAGGGGAGAGGGAGGCTGGCTGGTTT
GGTTGGACCACAAAGACACGCGATGCGTCGCCTCAGACAAAAAGGAGGAAGAAGAAAAAAAAAAAAAAGTCGGCC
CCGGTCGAGCCCCCACGCCTGCACCCGCACCTGAAATATGGACGGCAGGCTCCTGAAACTGACGTGCCAAACAGT
GTCCTCCTGGCCGAGTCTACCTCACGAGTCTCCTCCCGCCGCAGGTGCCGCCATAGTGAGGCCACGCACCCCTTG
TCCACCGGGGGGCTCAAGTGTTGGGAGCCCTGCCGACTGGAGCCCATCGTCTCATCGCCTGCCAGCGCCACGGCA
AATCGTCCTGCGTCCGCAGGCACGGCCAATCCACCGTCTGAAACGGACCCGGACAGGATGGAGACGTACCACGGC
TACGTGCGCACCCCCGGCGACGCCATCAAGCTGTTCGAGGCCTGCCGCCTGGGCCTGCTGCCGCGCGTCCAGCGC
CGGCTGTCGGAGAAGGAGCGGCAGTCGATCCGCTCCGGCTCCGTCTTCGTCTGGGACGAGCGCGAGGCCGGCATG
CGGAGGTGGACCGACGGCAAGTCGTGGAGCGCCAGCCGCGTCTCCGGCAGCTTCCTGACCTACCGCGAGATGGAG
GGCAAGCGCGGCGGCGGCTTCGGCAGCGGCCGGAGGGGCGCCGGCAAGACGCCCGACTCGGGCCGCGGCAGCGAC
GAGGACCACGACGACGGCGAGCCCGAGGGCTACCGCTACAAGGCCGACGGCCTGATGAAGCAGTCGTTCAGCATC
ACCACCTCGACCAACCAGCACCTGCACCTCATCTCCTACTACTCGCGCCCCCAGCCGGGCCAGCCCGACCTCAAC
CAGCCGAGCTCCGACCCGTCCCTGCGCGGCATCGTCCCGCCCAAGGGCATGTACCCCGAGTCGAGCATGGGCGAG
ACGAACCAGACGCCCGCCCTGACGCGCGCCCCGATGCAGCAGCCGTACATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail