Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5172
Gene name
LocationContig_259:22291..22678
Strand-
Gene length (bp)387
Transcript length (bp)387
Coding sequence length (bp)387
Protein length (aa) 129

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01593 Amino_oxidase Flavin containing amine oxidoreductase 2.0E-14 21 99
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 1.9E-12 16 86
PF12831 FAD_oxidored FAD dependent oxidoreductase 1.5E-06 13 90
PF00890 FAD_binding_2 FAD binding domain 1.4E-05 14 50

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P19643|AOFB_RAT Amine oxidase [flavin-containing] B OS=Rattus norvegicus GN=Maob PE=1 SV=3 11 93 5.0E-11
sp|Q8BW75|AOFB_MOUSE Amine oxidase [flavin-containing] B OS=Mus musculus GN=Maob PE=1 SV=4 11 93 9.0E-11
sp|P49253|AOF_ONCMY Amine oxidase [flavin-containing] OS=Oncorhynchus mykiss GN=mao PE=2 SV=2 14 93 7.0E-09
sp|P40974|PUO_KOCRO Putrescine oxidase OS=Kocuria rosea GN=puo PE=1 SV=1 3 110 3.0E-08
sp|Q6Q2J0|AOFA_PIG Amine oxidase [flavin-containing] A OS=Sus scrofa GN=MAOA PE=2 SV=1 12 93 7.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P19643|AOFB_RAT Amine oxidase [flavin-containing] B OS=Rattus norvegicus GN=Maob PE=1 SV=3 11 93 5.0E-11
sp|Q8BW75|AOFB_MOUSE Amine oxidase [flavin-containing] B OS=Mus musculus GN=Maob PE=1 SV=4 11 93 9.0E-11
sp|P49253|AOF_ONCMY Amine oxidase [flavin-containing] OS=Oncorhynchus mykiss GN=mao PE=2 SV=2 14 93 7.0E-09
sp|P40974|PUO_KOCRO Putrescine oxidase OS=Kocuria rosea GN=puo PE=1 SV=1 3 110 3.0E-08
sp|Q6Q2J0|AOFA_PIG Amine oxidase [flavin-containing] A OS=Sus scrofa GN=MAOA PE=2 SV=1 12 93 7.0E-08
sp|Q64133|AOFA_MOUSE Amine oxidase [flavin-containing] A OS=Mus musculus GN=Maoa PE=1 SV=3 2 125 3.0E-07
sp|Q9VW97|LSDA_DROME Possible lysine-specific histone demethylase 1 OS=Drosophila melanogaster GN=Su(var)3-3 PE=1 SV=1 13 92 3.0E-07
sp|Q6NSN2|AOF_DANRE Amine oxidase [flavin-containing] OS=Danio rerio GN=mao PE=1 SV=1 14 93 3.0E-07
sp|Q5NU32|AOFA_HORSE Amine oxidase [flavin-containing] A OS=Equus caballus GN=MAOA PE=2 SV=1 14 93 4.0E-07
sp|P58027|AOFA_CANLF Amine oxidase [flavin-containing] A OS=Canis lupus familiaris GN=MAOA PE=2 SV=1 14 125 6.0E-07
sp|P50264|FMS1_YEAST Polyamine oxidase FMS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FMS1 PE=1 SV=1 4 75 6.0E-07
sp|Q5RE60|AOFA_PONAB Amine oxidase [flavin-containing] A OS=Pongo abelii GN=MAOA PE=2 SV=1 14 93 1.0E-06
sp|P21397|AOFA_HUMAN Amine oxidase [flavin-containing] A OS=Homo sapiens GN=MAOA PE=1 SV=1 14 93 1.0E-06
sp|Q8H191|PAO4_ARATH Probable polyamine oxidase 4 OS=Arabidopsis thaliana GN=PAO4 PE=1 SV=1 14 100 3.0E-06
sp|P58028|AOFB_CAVPO Amine oxidase [flavin-containing] B OS=Cavia porcellus GN=MAOB PE=2 SV=2 20 93 3.0E-06
sp|Q9SU79|PAO5_ARATH Probable polyamine oxidase 5 OS=Arabidopsis thaliana GN=PAO5 PE=2 SV=1 10 88 3.0E-06
sp|P21398|AOFA_BOVIN Amine oxidase [flavin-containing] A OS=Bos taurus GN=MAOA PE=2 SV=2 2 93 4.0E-06
sp|Q5RE98|AOFB_PONAB Amine oxidase [flavin-containing] B OS=Pongo abelii GN=MAOB PE=2 SV=3 21 93 9.0E-06
sp|P27338|AOFB_HUMAN Amine oxidase [flavin-containing] B OS=Homo sapiens GN=MAOB PE=1 SV=3 21 93 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5172
MLNMASSTPEKVQVVIVGAGLSGLCAARAVHNADLSYVVLEAMDHVGGKILSVPVDPSAKNSGVVDMGAAWINDT
SQSEIYGLAREFGFDLVKQRTGGTNLHRDFNGELHQIPYGKIANVSNTFPTPL*
Coding >Hirsu2|5172
ATGTTGAATATGGCGTCTTCAACGCCCGAGAAAGTTCAGGTCGTCATCGTCGGCGCTGGGCTTAGCGGCTTGTGC
GCTGCCCGGGCCGTTCACAACGCGGATCTTTCCTACGTCGTCCTGGAGGCCATGGACCACGTGGGCGGCAAGATC
CTGTCTGTACCCGTCGACCCATCCGCCAAGAATAGCGGAGTCGTGGATATGGGTGCTGCCTGGATCAACGACACG
TCGCAGTCGGAGATTTACGGCTTGGCTAGGGAGTTTGGCTTCGACCTGGTCAAGCAACGGACGGGCGGCACCAAC
CTACATAGAGATTTCAACGGCGAACTTCACCAAATTCCGTATGGCAAAATAGCCAACGTGAGCAACACCTTCCCC
ACTCCGTTATAG
Transcript >Hirsu2|5172
ATGTTGAATATGGCGTCTTCAACGCCCGAGAAAGTTCAGGTCGTCATCGTCGGCGCTGGGCTTAGCGGCTTGTGC
GCTGCCCGGGCCGTTCACAACGCGGATCTTTCCTACGTCGTCCTGGAGGCCATGGACCACGTGGGCGGCAAGATC
CTGTCTGTACCCGTCGACCCATCCGCCAAGAATAGCGGAGTCGTGGATATGGGTGCTGCCTGGATCAACGACACG
TCGCAGTCGGAGATTTACGGCTTGGCTAGGGAGTTTGGCTTCGACCTGGTCAAGCAACGGACGGGCGGCACCAAC
CTACATAGAGATTTCAACGGCGAACTTCACCAAATTCCGTATGGCAAAATAGCCAACGTGAGCAACACCTTCCCC
ACTCCGTTATAG
Gene >Hirsu2|5172
ATGTTGAATATGGCGTCTTCAACGCCCGAGAAAGTTCAGGTCGTCATCGTCGGCGCTGGGCTTAGCGGCTTGTGC
GCTGCCCGGGCCGTTCACAACGCGGATCTTTCCTACGTCGTCCTGGAGGCCATGGACCACGTGGGCGGCAAGATC
CTGTCTGTACCCGTCGACCCATCCGCCAAGAATAGCGGAGTCGTGGATATGGGTGCTGCCTGGATCAACGACACG
TCGCAGTCGGAGATTTACGGCTTGGCTAGGGAGTTTGGCTTCGACCTGGTCAAGCAACGGACGGGCGGCACCAAC
CTACATAGAGATTTCAACGGCGAACTTCACCAAATTCCGTATGGCAAAATAGCCAACGTGAGCAACACCTTCCCC
ACTCCGTTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail