Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5151
Gene name
LocationContig_258:12645..19510
Strand-
Gene length (bp)6865
Transcript length (bp)6222
Coding sequence length (bp)6222
Protein length (aa) 2074

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14765 PS-DH Polyketide synthase dehydratase 1.5E-65 514 793
PF08659 KR KR domain 1.5E-57 1684 1859
PF00698 Acyl_transf_1 Acyl transferase domain 1.9E-55 144 456
PF13602 ADH_zinc_N_2 Zinc-binding dehydrogenase 8.1E-17 1522 1656
PF08242 Methyltransf_12 Methyltransferase domain 1.2E-16 983 1088
PF00107 ADH_zinc_N Zinc-binding dehydrogenase 3.6E-14 1481 1575
PF13649 Methyltransf_25 Methyltransferase domain 6.4E-10 982 1086
PF13489 Methyltransf_23 Methyltransferase domain 1.1E-08 976 1141
PF00106 adh_short short chain dehydrogenase 1.6E-07 1687 1840
PF08241 Methyltransf_11 Methyltransferase domain 3.8E-08 983 1090
PF13847 Methyltransf_31 Methyltransferase domain 4.2E-07 980 1094
PF08240 ADH_N Alcohol dehydrogenase GroES-like domain 5.0E-06 1381 1442
PF00550 PP-binding Phosphopantetheine attachment site 6.7E-05 1995 2054

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 72 2061 0.0E+00
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 73 1291 1.0E-132
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 140 1167 1.0E-115
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 140 1167 3.0E-114
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 140 1896 4.0E-108
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 72 2061 0.0E+00
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 73 1291 1.0E-132
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 140 1167 1.0E-115
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 140 1167 3.0E-114
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 140 1896 4.0E-108
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 13 1309 5.0E-88
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 139 1903 2.0E-87
sp|Q54IX3|PKS26_DICDI Probable polyketide synthase 26 OS=Dictyostelium discoideum GN=pks26 PE=3 SV=1 60 2070 2.0E-87
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 69 2067 2.0E-85
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 1356 2073 3.0E-77
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 1356 2073 3.0E-77
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 1356 1863 1.0E-60
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 1356 1863 1.0E-60
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 1356 1863 1.0E-60
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 1356 1863 1.0E-60
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 1356 1863 1.0E-60
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 1356 1861 5.0E-60
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 1356 1871 9.0E-60
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 1230 1863 1.0E-59
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 1356 1856 3.0E-58
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 1226 1863 1.0E-57
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 979 2050 1.0E-54
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 979 1903 5.0E-54
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 1363 1903 1.0E-53
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 947 1864 1.0E-52
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 1325 1896 6.0E-52
sp|Q86JI5|PKS5_DICDI Probable polyketide synthase 5 OS=Dictyostelium discoideum GN=pks5 PE=2 SV=1 909 1869 7.0E-52
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 908 2073 9.0E-52
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 1225 1903 3.0E-51
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 1393 2036 9.0E-51
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 1393 2036 2.0E-50
sp|B0G100|PKS7_DICDI Probable polyketide synthase 7 OS=Dictyostelium discoideum GN=pks7 PE=3 SV=1 983 2064 8.0E-48
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 1393 1880 2.0E-47
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 58 717 4.0E-46
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 58 717 4.0E-46
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 58 717 4.0E-46
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 58 717 4.0E-46
sp|Q869X2|PKS17_DICDI Probable polyketide synthase 17 OS=Dictyostelium discoideum GN=pks17 PE=3 SV=1 1383 2034 2.0E-45
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 833 2060 2.0E-45
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 58 717 3.0E-45
sp|Q54ED7|PKS40_DICDI Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 908 2064 4.0E-45
sp|Q869W9|PKS16_DICDI Probable polyketide synthase 16 OS=Dictyostelium discoideum GN=pks16 PE=2 SV=1 1383 1855 4.0E-45
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 60 1146 2.0E-44
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 983 1869 3.0E-44
sp|Q54KU3|PKS25_DICDI Probable polyketide synthase 25 OS=Dictyostelium discoideum GN=pks25 PE=3 SV=1 1378 2049 7.0E-43
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 1272 2050 7.0E-43
sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 95 726 8.0E-43
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 95 726 9.0E-43
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 95 726 9.0E-43
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 1378 2068 2.0E-42
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 1367 1864 4.0E-42
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 1321 2063 2.0E-41
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 139 1143 3.0E-41
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 72 721 5.0E-41
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 1272 1903 6.0E-41
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 1284 2050 1.0E-40
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 1272 2050 1.0E-40
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 1319 2034 3.0E-40
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 68 726 2.0E-39
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 1315 2050 2.0E-39
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 72 722 7.0E-39
sp|B4XYB8|AZIB_STREG 5-methyl-1-naphthoate synthase OS=Streptomyces sahachiroi GN=aziB PE=1 SV=1 58 633 1.0E-38
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 1679 2060 2.0E-38
sp|Q869W9|PKS16_DICDI Probable polyketide synthase 16 OS=Dictyostelium discoideum GN=pks16 PE=2 SV=1 69 682 2.0E-38
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 68 509 3.0E-38
sp|Q54QD3|PKS22_DICDI Probable polyketide synthase 22 OS=Dictyostelium discoideum GN=pks22 PE=3 SV=1 16 563 5.0E-38
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 69 563 6.0E-38
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 69 560 2.0E-37
sp|Q869X2|PKS17_DICDI Probable polyketide synthase 17 OS=Dictyostelium discoideum GN=pks17 PE=3 SV=1 69 682 3.0E-37
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 1319 1903 3.0E-37
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 72 497 5.0E-37
sp|B0G100|PKS7_DICDI Probable polyketide synthase 7 OS=Dictyostelium discoideum GN=pks7 PE=3 SV=1 69 560 5.0E-36
sp|Q54QD1|PKS23_DICDI Probable polyketide synthase 23 OS=Dictyostelium discoideum GN=pks23 PE=3 SV=1 16 563 5.0E-36
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 1319 1898 1.0E-35
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 15 572 3.0E-35
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 101 501 4.0E-34
sp|P22367|MSAS_PENPA 6-methylsalicylic acid synthase OS=Penicillium patulum PE=1 SV=1 53 591 7.0E-34
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 72 725 2.0E-33
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 1314 2052 2.0E-33
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 1272 2050 2.0E-33
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 72 725 3.0E-33
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 103 497 3.0E-33
sp|Q86JI5|PKS5_DICDI Probable polyketide synthase 5 OS=Dictyostelium discoideum GN=pks5 PE=2 SV=1 69 560 8.0E-33
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 1237 2052 1.0E-32
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 69 634 6.0E-32
sp|Q54QD3|PKS22_DICDI Probable polyketide synthase 22 OS=Dictyostelium discoideum GN=pks22 PE=3 SV=1 1285 1853 8.0E-32
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 131 678 1.0E-31
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 86 753 1.0E-31
sp|Q54KU3|PKS25_DICDI Probable polyketide synthase 25 OS=Dictyostelium discoideum GN=pks25 PE=3 SV=1 140 717 2.0E-31
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 72 499 2.0E-31
sp|Q54QD1|PKS23_DICDI Probable polyketide synthase 23 OS=Dictyostelium discoideum GN=pks23 PE=3 SV=1 1378 2052 3.0E-31
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 1378 1864 5.0E-31
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 144 683 6.0E-31
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 63 717 7.0E-31
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 51 559 9.0E-31
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 137 589 1.0E-30
sp|Q54KU5|PKS24_DICDI Probable polyketide synthase 24 OS=Dictyostelium discoideum GN=pks24 PE=3 SV=1 1378 1864 1.0E-30
sp|Q54KU5|PKS24_DICDI Probable polyketide synthase 24 OS=Dictyostelium discoideum GN=pks24 PE=3 SV=1 69 560 3.0E-30
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 142 497 9.0E-30
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 1375 1864 9.0E-30
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 144 678 2.0E-29
sp|P9WQE1|PPSE_MYCTU Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsE PE=1 SV=1 15 503 7.0E-29
sp|P9WQE0|PPSE_MYCTO Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsE PE=3 SV=1 15 503 7.0E-29
sp|Q7TXL6|PPSE_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsE PE=1 SV=1 15 503 7.0E-29
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 69 603 2.0E-28
sp|Q55DM7|PKS2_DICDI Probable polyketide synthase 2 OS=Dictyostelium discoideum GN=pks2 PE=3 SV=1 1237 1894 2.0E-28
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 60 589 5.0E-28
sp|Q12053|PKSL1_ASPPA Noranthrone synthase OS=Aspergillus parasiticus GN=pksL1 PE=1 SV=1 67 491 8.0E-28
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 69 571 1.0E-27
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 139 717 1.0E-27
sp|Q55DM7|PKS2_DICDI Probable polyketide synthase 2 OS=Dictyostelium discoideum GN=pks2 PE=3 SV=1 101 496 1.0E-27
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 139 680 3.0E-27
sp|B0G103|PKS10_DICDI Probable polyketide synthase 10 OS=Dictyostelium discoideum GN=pks10 PE=3 SV=1 39 723 4.0E-27
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 142 467 6.0E-27
sp|Q54ED7|PKS40_DICDI Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 69 572 1.0E-26
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 139 717 2.0E-26
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 139 714 2.0E-26
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 63 723 2.0E-26
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 1684 2060 3.0E-26
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 135 472 6.0E-26
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 1684 2060 7.0E-26
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 139 723 8.0E-26
sp|Q99536|VAT1_HUMAN Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens GN=VAT1 PE=1 SV=2 1382 1663 3.0E-25
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 69 603 4.0E-25
sp|Q8JFV8|VAT1_DANRE Synaptic vesicle membrane protein VAT-1 homolog OS=Danio rerio GN=vat1 PE=2 SV=1 1357 1657 6.0E-25
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 95 719 1.0E-24
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 95 719 1.0E-24
sp|Q03149|WA_EMENI Conidial yellow pigment biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=wA PE=1 SV=2 67 501 2.0E-24
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 69 717 6.0E-24
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 64 717 1.0E-23
sp|Q12397|STCA_EMENI Putative sterigmatocystin biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcA PE=3 SV=2 65 496 1.0E-23
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 131 683 2.0E-23
sp|P9WQE5|PPSB_MYCTU Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsB PE=1 SV=1 98 496 5.0E-23
sp|P9WQE4|PPSB_MYCTO Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsB PE=3 SV=1 98 496 5.0E-23
sp|Q7TXL9|PPSB_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsB PE=1 SV=1 98 496 6.0E-23
sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 1700 2054 2.0E-22
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 1700 2054 2.0E-22
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 1700 2054 2.0E-22
sp|Q3MIE4|VAT1_RAT Synaptic vesicle membrane protein VAT-1 homolog OS=Rattus norvegicus GN=Vat1 PE=1 SV=1 1382 1663 4.0E-22
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 63 725 1.0E-21
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 140 717 1.0E-21
sp|Q62465|VAT1_MOUSE Synaptic vesicle membrane protein VAT-1 homolog OS=Mus musculus GN=Vat1 PE=1 SV=3 1382 1663 4.0E-21
sp|P40783|QOR_SALTY Quinone oxidoreductase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=qor PE=3 SV=2 1355 1572 1.0E-20
sp|A7Z4X9|BAED_BACMF Polyketide biosynthesis acyltransferase homolog BaeD OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeD PE=1 SV=1 142 445 2.0E-20
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 1701 1872 2.0E-19
sp|P9WQE7|PPSA_MYCTU Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsA PE=1 SV=1 98 454 2.0E-19
sp|P9WQE6|PPSA_MYCTO Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsA PE=3 SV=1 98 454 2.0E-19
sp|P28304|QOR1_ECOLI Quinone oxidoreductase 1 OS=Escherichia coli (strain K12) GN=qorA PE=1 SV=1 1355 1646 6.0E-19
sp|Q7TXM0|PPSA_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsA PE=1 SV=1 98 454 6.0E-19
sp|Q9HCJ6|VAT1L_HUMAN Synaptic vesicle membrane protein VAT-1 homolog-like OS=Homo sapiens GN=VAT1L PE=1 SV=2 1357 1658 6.0E-18
sp|Q80TB8|VAT1L_MOUSE Synaptic vesicle membrane protein VAT-1 homolog-like OS=Mus musculus GN=Vat1l PE=1 SV=2 1357 1658 8.0E-18
sp|Q6AYT0|QOR_RAT Quinone oxidoreductase OS=Rattus norvegicus GN=Cryz PE=2 SV=1 1376 1656 5.0E-17
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 1700 1868 7.0E-17
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 1700 1868 7.0E-17
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 1698 1866 1.0E-16
sp|O34877|PKSD_BACSU Polyketide biosynthesis acyltransferase homolog PksD OS=Bacillus subtilis (strain 168) GN=pksD PE=1 SV=2 142 445 1.0E-16
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 1684 1872 2.0E-16
sp|P22367|MSAS_PENPA 6-methylsalicylic acid synthase OS=Penicillium patulum PE=1 SV=1 1684 1842 2.0E-16
sp|P19333|VAT1_TORCA Synaptic vesicle membrane protein VAT-1 OS=Torpedo californica PE=1 SV=1 1376 1674 2.0E-16
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 1681 1845 2.0E-16
sp|P73242|FABD_SYNY3 Malonyl CoA-acyl carrier protein transacylase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabD PE=1 SV=1 143 447 3.0E-16
sp|P71019|FABD_BACSU Malonyl CoA-acyl carrier protein transacylase OS=Bacillus subtilis (strain 168) GN=fabD PE=3 SV=2 142 430 7.0E-16
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 931 1143 9.0E-16
sp|Q53FA7|QORX_HUMAN Quinone oxidoreductase PIG3 OS=Homo sapiens GN=TP53I3 PE=1 SV=2 1375 1659 9.0E-16
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 1669 1856 1.0E-15
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 1681 1845 1.0E-15
sp|A7Z4Y0|BAEE_BACMF Polyketide biosynthesis protein BaeE OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeE PE=1 SV=1 142 350 3.0E-15
sp|B4XYB8|AZIB_STREG 5-methyl-1-naphthoate synthase OS=Streptomyces sahachiroi GN=aziB PE=1 SV=1 1684 1843 2.0E-14
sp|P47199|QOR_MOUSE Quinone oxidoreductase OS=Mus musculus GN=Cryz PE=1 SV=1 1376 1656 2.0E-14
sp|P38230|QOR_YEAST Probable quinone oxidoreductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZTA1 PE=1 SV=1 1357 1659 3.0E-13
sp|O34787|PKSE_BACSU Polyketide biosynthesis protein PksE OS=Bacillus subtilis (strain 168) GN=pksE PE=1 SV=3 142 351 3.0E-13
sp|P11415|QOR_CAVPO Quinone oxidoreductase OS=Cavia porcellus GN=CRYZ PE=1 SV=1 1376 1658 4.0E-13
sp|O97764|QOR_BOVIN Zeta-crystallin OS=Bos taurus GN=CRYZ PE=2 SV=2 1376 1599 4.0E-13
sp|A7Z4X8|BAEC_BACMF Polyketide biosynthesis malonyl CoA-acyl carrier protein transacylase BaeC OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeC PE=1 SV=1 142 420 5.0E-13
sp|Q0MVN8|QOR_PIG Quinone oxidoreductase OS=Sus scrofa GN=CRYZ PE=2 SV=1 1355 1656 8.0E-13
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 1681 1844 1.0E-12
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 1010 1299 1.0E-12
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 979 1143 2.0E-12
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 979 1143 2.0E-12
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 1665 2062 2.0E-12
sp|Q08257|QOR_HUMAN Quinone oxidoreductase OS=Homo sapiens GN=CRYZ PE=1 SV=1 1376 1656 2.0E-12
sp|P43903|QOR_PSEAE Quinone oxidoreductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=qor PE=3 SV=2 1356 1572 5.0E-12
sp|Q59I44|CAA43_BURSP 2-haloacrylate reductase OS=Burkholderia sp. GN=caa43 PE=1 SV=1 1358 1656 5.0E-12
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 979 1131 7.0E-12
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 947 1143 8.0E-12
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 1681 1845 8.0E-12
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 951 1143 1.0E-11
sp|Q5R4S7|QOR_PONAB Quinone oxidoreductase OS=Pongo abelii GN=CRYZ PE=2 SV=1 1376 1656 1.0E-11
sp|P9WQE7|PPSA_MYCTU Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsA PE=1 SV=1 1701 1843 4.0E-11
sp|P9WQE6|PPSA_MYCTO Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsA PE=3 SV=1 1701 1843 5.0E-11
sp|Q7TXM0|PPSA_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsA PE=1 SV=1 1701 1843 5.0E-11
sp|P42865|QOR_LEIAM Probable quinone oxidoreductase OS=Leishmania amazonensis PE=3 SV=1 1383 1658 6.0E-11
sp|O94564|YGD6_SCHPO Zinc-type alcohol dehydrogenase-like protein C1773.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.06c PE=3 SV=1 1366 1658 1.0E-10
sp|Q28452|QOR_LAMGU Quinone oxidoreductase OS=Lama guanicoe GN=CRYZ PE=2 SV=1 1376 1599 2.0E-10
sp|P9WQE5|PPSB_MYCTU Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsB PE=1 SV=1 1679 1870 3.0E-10
sp|P9WQE4|PPSB_MYCTO Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsB PE=3 SV=1 1679 1870 3.0E-10
sp|Q7TXL9|PPSB_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsB PE=1 SV=1 1679 2035 3.0E-10
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 1664 1854 4.0E-10
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 980 1140 5.0E-10
sp|B0G103|PKS10_DICDI Probable polyketide synthase 10 OS=Dictyostelium discoideum GN=pks10 PE=3 SV=1 979 1145 9.0E-10
sp|O34825|PKSC_BACSU Polyketide biosynthesis malonyl CoA-acyl carrier protein transacylase PksC OS=Bacillus subtilis (strain 168) GN=pksC PE=1 SV=1 142 354 1.0E-09
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 977 1143 2.0E-09
sp|Q9R9J2|FENF_BACIU Malonyl CoA-acyl carrier protein transacylase OS=Bacillus subtilis GN=fenF PE=1 SV=1 142 356 8.0E-09
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 1677 1840 2.0E-08
sp|A7RK30|QORL2_NEMVE Quinone oxidoreductase-like protein 2 homolog OS=Nematostella vectensis GN=v1g238856 PE=3 SV=1 1378 1657 2.0E-08
sp|Q6G9Y3|FABD_STAAS Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MSSA476) GN=fabD PE=3 SV=1 143 430 7.0E-08
sp|Q7A124|FABD_STAAW Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MW2) GN=fabD PE=3 SV=1 143 430 1.0E-07
sp|Q7A5Z3|FABD_STAAN Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain N315) GN=fabD PE=1 SV=1 143 430 1.0E-07
sp|Q99UN8|FABD_STAAM Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabD PE=1 SV=1 143 430 1.0E-07
sp|O85140|FABD_SALTY Malonyl CoA-acyl carrier protein transacylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fabD PE=1 SV=3 143 314 2.0E-07
sp|B0BNC9|QORL2_RAT Quinone oxidoreductase-like protein 2 OS=Rattus norvegicus PE=2 SV=1 1374 1658 3.0E-07
sp|Q93X62|FABG1_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 1, chloroplastic OS=Brassica napus GN=gbkr1 PE=1 SV=1 1693 1840 6.0E-07
sp|P0AAI9|FABD_ECOLI Malonyl CoA-acyl carrier protein transacylase OS=Escherichia coli (strain K12) GN=fabD PE=1 SV=2 143 314 6.0E-07
sp|P0AAJ0|FABD_ECOL6 Malonyl CoA-acyl carrier protein transacylase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fabD PE=3 SV=2 143 314 6.0E-07
sp|Q949M3|FABG3_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 3, chloroplastic OS=Brassica napus GN=bkr3 PE=2 SV=1 1693 1840 7.0E-07
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 1599 1855 8.0E-07
sp|Q3UNZ8|QORL2_MOUSE Quinone oxidoreductase-like protein 2 OS=Mus musculus PE=1 SV=1 1374 1658 9.0E-07
sp|Q8X8I7|FABD_ECO57 Malonyl CoA-acyl carrier protein transacylase OS=Escherichia coli O157:H7 GN=fabD PE=3 SV=3 143 314 1.0E-06
sp|Q8BGC4|ZADH2_MOUSE Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Mus musculus GN=Zadh2 PE=1 SV=1 1388 1659 2.0E-06
sp|A0R0B2|FABD_MYCS2 Malonyl CoA-acyl carrier protein transacylase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=fabD PE=1 SV=1 208 375 2.0E-06
sp|P28643|FABG_CUPLA 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic OS=Cuphea lanceolata GN=CLKR27 PE=2 SV=1 1693 1840 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5151
LHFGLSQKVIVDSAASFGVAGTAAASTAVTGHPEEEHGSGAEVDKQLETLVNGDGAKAGKTTKEQVSRLLPVSAN
NDTSLQSRVRALQAYIHSRSAPLAGIAYTLGSRRQHLSHRTFVVARDGAGLPEFGQLQKASPSAPCVAFVFTGQG
EQWFGMGKELIHNSPSFEADIRSMDMALQSLHDPPSWSIQGFLRCEQPEHLVHRAEYSQPLCTALQVALVNLLAK
CGISPGAVVGHSSGEIAGAYAAGTITMAEAISVAYYRGLAAKSQARQGCMAAVGLGREAVSPLLADGAVVACENS
PGSITISGDVEAVERTLELIKYKNPEALARKLSVDKAYHSHHMREVGQAYEASLLQKPILPEQPRVRFYSSLTGQ
RAEEDVLFGPAYWRQNLESPVLFRDAVEALLDDLGQSPLFLEVGPHGALREPVRQTVAGRSTENMAYITTLTRGS
DCFVDTLAALGRLYAHGCDVNFAFLNPPAPVLTDLPAYPWDHSQKFWTEDRLTRAWRYKQERHHEMLGSRCLESS
DIEVSWRNVLEASDVPWLGDHKIVNDIIFPCAGYVAMMGEAIRQTTGSESYTLRNMVVKAALMFEASETVELMTR
MKPVRLTDSANSSWSDLSIMALRKGTWAEHCVAQGKAGQQKTLPRREPVHYPRRVGKASWYERLAQLGLKYGPRF
RGMQRISSHTTETRAVAEIETETHAREARYAVHPTALDACLQLFTVSIARGLSRHMVTLCVPSAMGSISIKPADS
RLKAEAVASATPRGGIKGDVAVVAGADDVVVQIQDAIFRPLDSPDSVEDSAPPSNARLEWRPDVDFVDLGSTIRR
TTDKRKAKIWLQRVTALCILRALDALQSLDVPAGYLAKYVDWLRIEKRCMLDDEWAFMVPEARSWAELAPGSIET
LMPAILGDFGSVWDPNTRRCTQLLLKMSTPDNIRAVFQDDMHPLNLMMEDSLLESIYTFHTDLRDTGELISLCAH
AQPMMKVLEVGAGTATSTLNVLKALVSDDGTCMYSQYIFTDISAGFFAAAADKLRQYPNIDYKVFDIAKDPAKQG
FEPASYDLILADNVVHVAPSLQEALRNLRLLLRPGGRLVLGELVHRATFKVTRFATGLLPGWWAGEADGRHDGPL
VSAERWDDELRLAGFSGTGTVFLDDDSPYQVSFVMASTAVEARKADVGLSDVTFLYRGFKHEFALELAARLAQEG
IDIHWSQIGSNEAIDGRDVVSTVDLEGPYLHDISKTDYDRLVAHLSKLTSSTLWLTRAAQVESVDPRYGLTIGLA
RTIRTELGLRFSTLELQSLGPDAVDASAAVFHKLRRPSPSAHLDAESEFVFHDGAVLIGRYRWVRSTDETQVEVR
ADFPSRLVVGRYGQVDSMRWVQYPRPALEAHEVELDVRCVGLNFRDLLLAMGIVDDRKDSMGVEAAGVIARVGSA
VRHVKAGDRVMAIFNSCFSTRTAIPAQLVALIPEDLGFEDAATMSSSILVQSACGGVGLAALQICKTVGAQVYAT
VGSEEKIQHLVDNYGITRDRIFSSRDSSFLQGIMQATNGRGVDMVLNSLSGELLQAAWQCVAKHGKMMEIGKRDF
IGRGQLMLDPFEANRSFYGVDLYTILTDRPELSCQLLNQCIRYYKEGHIKPIRPIQVFPAQRAADAFRIMQRGQH
LGKLVISMPGLEETKQMTTTAFARPGAALSDNFTYFMVGGLGGLGKAVTRWMVERGARHFVFLSRSAGQTSEDQE
FLQELESQGCHAVAVAGSVVEQADVERAIQAATTPIAGVVHLSMVLRDGPLFEIDHANWAHVTGPKVIGAWNIHN
ALANSKLDFFILFSSVAAAVGQPGQANYSAANSFLESFAQYRRGLDLPCSVISLGVMQDIGYISGSSRLRNQVRS
TSSHIIQEGDLIEAMDIIIHQSRPSCASTGGPHAAYMYCNMGQLMVGLRSTKPLSDPGNRTIWKRDVRMSRYHRL
EVADERGTGPQGNQLDMLLDSVALNPGVLCNPETLEVITWGIGRMCCQMMMWPKENLDVNMSIVTMGVDSLVSIE
IRNWWRRTFGVETSTLKILGAGTIENLGAMALASLKEKHDVKEDLDQE*
Coding >Hirsu2|5151
CTGCATTTCGGGCTAAGCCAAAAGGTCATTGTCGACTCGGCCGCATCGTTCGGAGTGGCCGGCACCGCCGCAGCA
TCGACGGCCGTGACCGGGCATCCGGAGGAGGAGCATGGCTCCGGCGCGGAGGTTGACAAGCAGCTCGAGACGCTC
GTCAACGGCGACGGGGCCAAGGCTGGCAAGACGACCAAGGAGCAAGTGTCGCGTCTGCTCCCCGTGTCGGCGAAC
AACGACACGTCCCTGCAGTCGCGGGTCCGGGCCCTGCAGGCGTACATCCACAGCCGGTCCGCTCCGTTGGCGGGC
ATCGCGTACACGCTCGGGAGTCGCCGCCAGCATCTGTCCCACAGAACATTCGTCGTTGCCAGGGACGGTGCAGGA
CTTCCTGAGTTTGGACAGTTGCAAAAGGCCAGCCCGTCTGCCCCGTGTGTTGCGTTTGTCTTCACGGGGCAGGGA
GAGCAGTGGTTCGGCATGGGCAAGGAGCTCATTCACAACTCGCCCTCGTTCGAGGCGGATATTCGAAGCATGGAC
ATGGCTCTTCAGAGCCTCCATGACCCACCGTCCTGGTCCATCCAAGGCTTTCTCCGCTGCGAGCAGCCCGAGCAT
CTCGTCCACCGGGCTGAGTACTCACAGCCCCTATGTACGGCCCTGCAGGTCGCCTTAGTCAACCTCCTCGCCAAG
TGCGGCATCTCTCCTGGCGCCGTCGTCGGCCACTCGAGCGGAGAGATAGCCGGCGCGTACGCCGCCGGGACAATA
ACCATGGCAGAGGCCATCTCGGTCGCCTATTACCGCGGCCTGGCAGCCAAGAGCCAGGCTCGCCAGGGCTGCATG
GCTGCCGTGGGCCTGGGCCGCGAAGCTGTCTCGCCTCTGCTCGCCGACGGAGCTGTGGTCGCATGCGAGAACAGT
CCGGGCAGCATAACTATTTCGGGCGACGTCGAGGCCGTTGAGCGGACTCTTGAGCTGATCAAGTACAAGAATCCG
GAAGCCCTCGCTCGGAAGCTGTCTGTTGACAAGGCATACCACTCACATCACATGCGTGAAGTGGGACAAGCATAC
GAGGCCTCGCTCCTCCAGAAACCGATTCTTCCTGAGCAGCCGAGAGTCCGCTTCTACTCGAGCCTGACGGGCCAG
CGGGCTGAGGAAGATGTCCTCTTCGGGCCGGCCTACTGGAGGCAAAACCTCGAGTCGCCGGTGCTCTTCAGAGAC
GCGGTGGAGGCTCTGCTGGACGACTTGGGCCAGTCGCCGCTGTTCCTCGAGGTTGGCCCGCATGGCGCCTTGCGA
GAACCGGTTCGCCAGACGGTTGCCGGCCGCTCGACCGAGAACATGGCCTACATAACGACGCTGACCAGGGGCAGC
GACTGCTTCGTCGACACGCTCGCGGCGCTGGGTCGATTGTATGCCCACGGCTGTGATGTAAACTTCGCCTTCCTG
AACCCGCCGGCCCCAGTCCTGACGGATCTGCCGGCTTATCCATGGGACCACAGCCAGAAGTTCTGGACTGAAGAC
CGCCTCACGCGCGCCTGGAGATACAAACAGGAGAGGCATCACGAGATGCTCGGATCAAGGTGTCTGGAGAGCAGC
GATATCGAAGTCTCCTGGAGAAACGTGCTCGAGGCCTCGGATGTGCCCTGGCTTGGGGACCACAAGATCGTAAAC
GACATCATCTTCCCCTGCGCCGGATATGTCGCGATGATGGGCGAGGCCATCAGACAGACGACCGGCTCCGAGTCT
TATACTCTGCGAAACATGGTCGTCAAAGCAGCCCTGATGTTTGAGGCGTCCGAGACTGTAGAGCTGATGACGAGG
ATGAAACCGGTGCGACTGACGGACAGTGCCAACTCTTCTTGGTCGGACTTGTCCATCATGGCTTTGCGAAAAGGC
ACTTGGGCGGAGCACTGCGTCGCGCAGGGAAAGGCGGGCCAGCAGAAGACGCTGCCGCGAAGGGAGCCCGTGCAC
TATCCTCGCCGGGTGGGCAAGGCATCGTGGTATGAGCGGCTGGCGCAGCTGGGCCTCAAATACGGGCCGCGGTTT
CGCGGCATGCAGCGCATCTCCTCCCACACGACCGAGACGAGGGCCGTGGCAGAGATCGAGACGGAGACGCATGCT
CGGGAGGCGCGGTACGCCGTACACCCGACCGCTCTGGACGCCTGCCTGCAGCTCTTCACCGTTTCCATCGCGAGG
GGGCTCTCCCGCCACATGGTGACGCTCTGCGTCCCTTCTGCCATGGGTAGCATCAGCATCAAGCCCGCGGACAGC
CGTCTCAAGGCCGAGGCCGTCGCCTCTGCAACCCCTAGGGGGGGCATCAAGGGAGATGTAGCTGTGGTCGCCGGG
GCGGACGATGTGGTTGTACAGATCCAAGACGCCATCTTCCGTCCGCTGGATAGCCCAGACTCGGTGGAAGACTCG
GCGCCTCCTTCCAACGCCCGTCTGGAGTGGCGTCCAGACGTGGACTTTGTCGATCTCGGCAGCACGATACGAAGG
ACGACCGACAAGCGCAAGGCCAAGATATGGCTTCAGCGAGTCACCGCCTTGTGCATCCTGCGGGCTCTCGACGCG
CTTCAGTCATTGGACGTGCCGGCGGGATACCTGGCCAAGTACGTGGACTGGCTGCGGATCGAGAAGAGGTGCATG
CTCGACGATGAATGGGCCTTTATGGTCCCCGAGGCGCGGTCGTGGGCGGAGCTGGCTCCCGGGAGCATCGAGACC
TTGATGCCCGCCATCCTCGGCGACTTCGGCAGCGTCTGGGACCCAAATACACGGAGATGCACGCAGTTGCTCCTC
AAGATGTCGACCCCTGACAACATTCGAGCCGTCTTCCAGGACGATATGCACCCCTTGAATCTAATGATGGAGGAC
AGCTTGCTCGAGAGCATATACACCTTTCACACAGATTTGAGGGACACGGGCGAGCTCATCTCCCTCTGCGCTCAC
GCCCAGCCGATGATGAAGGTGCTCGAAGTGGGAGCTGGTACCGCAACGTCCACACTGAACGTACTCAAGGCCCTG
GTGTCAGACGACGGCACGTGCATGTACTCGCAATACATCTTTACCGACATCTCGGCGGGCTTCTTTGCCGCGGCC
GCGGACAAGCTCAGGCAGTACCCAAATATCGACTACAAGGTGTTCGACATCGCCAAGGATCCGGCCAAGCAGGGC
TTTGAGCCGGCATCCTACGACCTCATCCTGGCCGACAACGTTGTTCATGTTGCCCCGTCGCTGCAGGAGGCCCTT
CGCAACCTTCGCCTGCTCCTCCGTCCAGGCGGCCGACTCGTTCTGGGGGAGTTGGTCCATCGAGCGACATTTAAA
GTCACCCGTTTCGCCACGGGCCTTTTGCCTGGCTGGTGGGCTGGCGAAGCTGACGGCCGTCACGACGGGCCACTC
GTCTCGGCGGAGCGCTGGGATGATGAGCTTCGGCTGGCAGGCTTCTCTGGAACCGGCACGGTCTTCCTGGACGAC
GACTCACCCTACCAGGTCAGCTTCGTGATGGCCTCCACGGCGGTCGAGGCCCGCAAGGCCGATGTCGGCCTCAGT
GATGTCACGTTTCTGTACCGCGGCTTTAAGCACGAGTTTGCCCTCGAGCTGGCGGCTAGGCTCGCGCAGGAGGGC
ATCGACATCCACTGGAGCCAGATCGGCAGCAACGAAGCCATCGACGGACGAGACGTCGTCTCGACGGTCGATCTG
GAAGGCCCCTATCTGCACGACATCTCCAAGACCGACTACGACAGGCTTGTGGCTCACCTATCGAAGCTCACGTCC
AGCACGCTATGGCTCACGCGCGCGGCTCAGGTGGAAAGCGTTGATCCTCGCTACGGGCTGACCATCGGCCTGGCG
CGCACCATACGCACAGAGCTCGGACTCCGATTTTCCACGCTCGAGCTTCAGTCCCTCGGGCCTGACGCTGTAGAT
GCTTCCGCGGCTGTCTTTCACAAGCTTCGACGCCCTAGCCCATCCGCCCATCTTGACGCCGAGTCCGAGTTCGTC
TTCCACGACGGGGCTGTCCTCATCGGCCGATATCGTTGGGTTCGCTCCACGGACGAGACGCAGGTAGAGGTGCGG
GCAGATTTCCCGAGCCGTCTGGTCGTTGGCAGGTATGGGCAGGTCGATTCGATGCGCTGGGTTCAGTATCCTCGG
CCTGCGCTTGAAGCTCACGAAGTGGAGCTGGACGTGCGCTGTGTAGGCCTCAACTTTAGGGACCTTCTCCTGGCA
ATGGGCATCGTCGACGACCGGAAGGACAGCATGGGAGTCGAGGCTGCTGGGGTCATTGCACGCGTCGGATCGGCA
GTCCGTCACGTTAAGGCGGGCGACCGTGTCATGGCCATATTTAACAGCTGTTTCTCAACGCGGACGGCCATCCCC
GCGCAGCTGGTTGCCCTGATCCCGGAAGACCTTGGCTTCGAGGACGCGGCAACCATGTCTTCGTCTATCTTGGTC
CAGTCCGCCTGCGGCGGTGTCGGGCTGGCGGCCCTCCAAATTTGCAAGACGGTCGGGGCTCAAGTCTATGCCACT
GTGGGAAGCGAGGAAAAGATACAGCATCTGGTGGACAACTACGGCATTACACGCGACCGCATCTTCTCCTCCCGC
GACTCCTCATTCTTACAGGGCATCATGCAGGCGACAAACGGCCGCGGAGTCGACATGGTGCTAAACTCACTCTCC
GGCGAGCTTCTTCAAGCGGCGTGGCAGTGCGTCGCCAAGCACGGCAAGATGATGGAGATCGGGAAGCGGGACTTT
ATCGGTCGCGGGCAGCTCATGCTCGATCCCTTCGAGGCCAACCGCTCCTTTTACGGAGTCGACCTGTACACCATC
CTTACAGACCGCCCGGAGCTTTCATGCCAGCTGCTTAATCAGTGCATCCGCTACTACAAGGAAGGACACATCAAG
CCCATTCGGCCGATTCAAGTCTTCCCGGCCCAGAGAGCGGCGGACGCATTCCGCATCATGCAAAGGGGGCAGCAT
CTAGGGAAGCTGGTCATCTCGATGCCTGGTCTGGAAGAGACCAAGCAGATGACGACGACTGCGTTCGCGAGGCCC
GGAGCGGCGCTCTCTGACAATTTCACCTATTTCATGGTCGGGGGGCTCGGTGGCCTGGGCAAGGCCGTCACCAGG
TGGATGGTCGAGCGAGGTGCCAGACACTTTGTCTTCTTGTCTCGCTCCGCCGGCCAGACAAGTGAGGACCAAGAG
TTCCTCCAAGAGCTGGAGTCTCAGGGCTGCCACGCCGTTGCCGTGGCCGGCAGCGTTGTCGAGCAGGCAGATGTC
GAGCGCGCGATTCAGGCCGCAACAACGCCTATAGCCGGCGTTGTCCACCTGTCTATGGTGCTAAGGGACGGGCCT
CTGTTCGAGATTGATCACGCAAACTGGGCTCACGTCACAGGGCCCAAAGTGATCGGGGCTTGGAATATCCACAAC
GCACTCGCCAACTCCAAGCTCGACTTTTTCATCCTCTTCAGCTCCGTCGCCGCCGCGGTTGGTCAACCCGGGCAA
GCCAACTATTCCGCCGCCAATTCCTTTCTGGAGTCCTTTGCACAGTACCGCCGCGGCCTTGACCTGCCCTGCTCC
GTCATCTCCCTAGGCGTTATGCAGGACATTGGCTACATTAGCGGGAGTTCTAGGCTGCGGAACCAGGTCCGCAGC
ACGTCGTCACACATAATTCAAGAGGGCGATCTGATCGAGGCCATGGATATCATCATCCACCAATCTCGGCCCTCT
TGCGCCTCTACCGGCGGGCCTCACGCGGCCTATATGTATTGCAACATGGGACAGCTCATGGTGGGGTTGCGGTCG
ACGAAGCCGCTGTCCGATCCCGGAAACCGCACCATATGGAAGCGAGACGTGCGCATGAGTCGCTACCACCGGCTA
GAGGTGGCCGACGAGCGCGGAACCGGCCCGCAGGGCAACCAACTCGATATGCTGCTCGACTCAGTCGCCTTGAAC
CCGGGCGTGCTATGCAACCCGGAGACGCTCGAGGTGATTACGTGGGGGATTGGCCGCATGTGCTGCCAAATGATG
ATGTGGCCCAAGGAGAACCTGGATGTGAACATGAGCATAGTCACGATGGGCGTCGACTCACTAGTGAGCATCGAG
ATCCGAAACTGGTGGCGGCGGACGTTTGGGGTTGAAACTAGCACCCTTAAGATCTTGGGGGCCGGGACGATTGAG
AATCTGGGAGCCATGGCCCTGGCTTCGCTCAAGGAAAAGCATGACGTCAAGGAAGATTTGGACCAGGAATGA
Transcript >Hirsu2|5151
CTGCATTTCGGGCTAAGCCAAAAGGTCATTGTCGACTCGGCCGCATCGTTCGGAGTGGCCGGCACCGCCGCAGCA
TCGACGGCCGTGACCGGGCATCCGGAGGAGGAGCATGGCTCCGGCGCGGAGGTTGACAAGCAGCTCGAGACGCTC
GTCAACGGCGACGGGGCCAAGGCTGGCAAGACGACCAAGGAGCAAGTGTCGCGTCTGCTCCCCGTGTCGGCGAAC
AACGACACGTCCCTGCAGTCGCGGGTCCGGGCCCTGCAGGCGTACATCCACAGCCGGTCCGCTCCGTTGGCGGGC
ATCGCGTACACGCTCGGGAGTCGCCGCCAGCATCTGTCCCACAGAACATTCGTCGTTGCCAGGGACGGTGCAGGA
CTTCCTGAGTTTGGACAGTTGCAAAAGGCCAGCCCGTCTGCCCCGTGTGTTGCGTTTGTCTTCACGGGGCAGGGA
GAGCAGTGGTTCGGCATGGGCAAGGAGCTCATTCACAACTCGCCCTCGTTCGAGGCGGATATTCGAAGCATGGAC
ATGGCTCTTCAGAGCCTCCATGACCCACCGTCCTGGTCCATCCAAGGCTTTCTCCGCTGCGAGCAGCCCGAGCAT
CTCGTCCACCGGGCTGAGTACTCACAGCCCCTATGTACGGCCCTGCAGGTCGCCTTAGTCAACCTCCTCGCCAAG
TGCGGCATCTCTCCTGGCGCCGTCGTCGGCCACTCGAGCGGAGAGATAGCCGGCGCGTACGCCGCCGGGACAATA
ACCATGGCAGAGGCCATCTCGGTCGCCTATTACCGCGGCCTGGCAGCCAAGAGCCAGGCTCGCCAGGGCTGCATG
GCTGCCGTGGGCCTGGGCCGCGAAGCTGTCTCGCCTCTGCTCGCCGACGGAGCTGTGGTCGCATGCGAGAACAGT
CCGGGCAGCATAACTATTTCGGGCGACGTCGAGGCCGTTGAGCGGACTCTTGAGCTGATCAAGTACAAGAATCCG
GAAGCCCTCGCTCGGAAGCTGTCTGTTGACAAGGCATACCACTCACATCACATGCGTGAAGTGGGACAAGCATAC
GAGGCCTCGCTCCTCCAGAAACCGATTCTTCCTGAGCAGCCGAGAGTCCGCTTCTACTCGAGCCTGACGGGCCAG
CGGGCTGAGGAAGATGTCCTCTTCGGGCCGGCCTACTGGAGGCAAAACCTCGAGTCGCCGGTGCTCTTCAGAGAC
GCGGTGGAGGCTCTGCTGGACGACTTGGGCCAGTCGCCGCTGTTCCTCGAGGTTGGCCCGCATGGCGCCTTGCGA
GAACCGGTTCGCCAGACGGTTGCCGGCCGCTCGACCGAGAACATGGCCTACATAACGACGCTGACCAGGGGCAGC
GACTGCTTCGTCGACACGCTCGCGGCGCTGGGTCGATTGTATGCCCACGGCTGTGATGTAAACTTCGCCTTCCTG
AACCCGCCGGCCCCAGTCCTGACGGATCTGCCGGCTTATCCATGGGACCACAGCCAGAAGTTCTGGACTGAAGAC
CGCCTCACGCGCGCCTGGAGATACAAACAGGAGAGGCATCACGAGATGCTCGGATCAAGGTGTCTGGAGAGCAGC
GATATCGAAGTCTCCTGGAGAAACGTGCTCGAGGCCTCGGATGTGCCCTGGCTTGGGGACCACAAGATCGTAAAC
GACATCATCTTCCCCTGCGCCGGATATGTCGCGATGATGGGCGAGGCCATCAGACAGACGACCGGCTCCGAGTCT
TATACTCTGCGAAACATGGTCGTCAAAGCAGCCCTGATGTTTGAGGCGTCCGAGACTGTAGAGCTGATGACGAGG
ATGAAACCGGTGCGACTGACGGACAGTGCCAACTCTTCTTGGTCGGACTTGTCCATCATGGCTTTGCGAAAAGGC
ACTTGGGCGGAGCACTGCGTCGCGCAGGGAAAGGCGGGCCAGCAGAAGACGCTGCCGCGAAGGGAGCCCGTGCAC
TATCCTCGCCGGGTGGGCAAGGCATCGTGGTATGAGCGGCTGGCGCAGCTGGGCCTCAAATACGGGCCGCGGTTT
CGCGGCATGCAGCGCATCTCCTCCCACACGACCGAGACGAGGGCCGTGGCAGAGATCGAGACGGAGACGCATGCT
CGGGAGGCGCGGTACGCCGTACACCCGACCGCTCTGGACGCCTGCCTGCAGCTCTTCACCGTTTCCATCGCGAGG
GGGCTCTCCCGCCACATGGTGACGCTCTGCGTCCCTTCTGCCATGGGTAGCATCAGCATCAAGCCCGCGGACAGC
CGTCTCAAGGCCGAGGCCGTCGCCTCTGCAACCCCTAGGGGGGGCATCAAGGGAGATGTAGCTGTGGTCGCCGGG
GCGGACGATGTGGTTGTACAGATCCAAGACGCCATCTTCCGTCCGCTGGATAGCCCAGACTCGGTGGAAGACTCG
GCGCCTCCTTCCAACGCCCGTCTGGAGTGGCGTCCAGACGTGGACTTTGTCGATCTCGGCAGCACGATACGAAGG
ACGACCGACAAGCGCAAGGCCAAGATATGGCTTCAGCGAGTCACCGCCTTGTGCATCCTGCGGGCTCTCGACGCG
CTTCAGTCATTGGACGTGCCGGCGGGATACCTGGCCAAGTACGTGGACTGGCTGCGGATCGAGAAGAGGTGCATG
CTCGACGATGAATGGGCCTTTATGGTCCCCGAGGCGCGGTCGTGGGCGGAGCTGGCTCCCGGGAGCATCGAGACC
TTGATGCCCGCCATCCTCGGCGACTTCGGCAGCGTCTGGGACCCAAATACACGGAGATGCACGCAGTTGCTCCTC
AAGATGTCGACCCCTGACAACATTCGAGCCGTCTTCCAGGACGATATGCACCCCTTGAATCTAATGATGGAGGAC
AGCTTGCTCGAGAGCATATACACCTTTCACACAGATTTGAGGGACACGGGCGAGCTCATCTCCCTCTGCGCTCAC
GCCCAGCCGATGATGAAGGTGCTCGAAGTGGGAGCTGGTACCGCAACGTCCACACTGAACGTACTCAAGGCCCTG
GTGTCAGACGACGGCACGTGCATGTACTCGCAATACATCTTTACCGACATCTCGGCGGGCTTCTTTGCCGCGGCC
GCGGACAAGCTCAGGCAGTACCCAAATATCGACTACAAGGTGTTCGACATCGCCAAGGATCCGGCCAAGCAGGGC
TTTGAGCCGGCATCCTACGACCTCATCCTGGCCGACAACGTTGTTCATGTTGCCCCGTCGCTGCAGGAGGCCCTT
CGCAACCTTCGCCTGCTCCTCCGTCCAGGCGGCCGACTCGTTCTGGGGGAGTTGGTCCATCGAGCGACATTTAAA
GTCACCCGTTTCGCCACGGGCCTTTTGCCTGGCTGGTGGGCTGGCGAAGCTGACGGCCGTCACGACGGGCCACTC
GTCTCGGCGGAGCGCTGGGATGATGAGCTTCGGCTGGCAGGCTTCTCTGGAACCGGCACGGTCTTCCTGGACGAC
GACTCACCCTACCAGGTCAGCTTCGTGATGGCCTCCACGGCGGTCGAGGCCCGCAAGGCCGATGTCGGCCTCAGT
GATGTCACGTTTCTGTACCGCGGCTTTAAGCACGAGTTTGCCCTCGAGCTGGCGGCTAGGCTCGCGCAGGAGGGC
ATCGACATCCACTGGAGCCAGATCGGCAGCAACGAAGCCATCGACGGACGAGACGTCGTCTCGACGGTCGATCTG
GAAGGCCCCTATCTGCACGACATCTCCAAGACCGACTACGACAGGCTTGTGGCTCACCTATCGAAGCTCACGTCC
AGCACGCTATGGCTCACGCGCGCGGCTCAGGTGGAAAGCGTTGATCCTCGCTACGGGCTGACCATCGGCCTGGCG
CGCACCATACGCACAGAGCTCGGACTCCGATTTTCCACGCTCGAGCTTCAGTCCCTCGGGCCTGACGCTGTAGAT
GCTTCCGCGGCTGTCTTTCACAAGCTTCGACGCCCTAGCCCATCCGCCCATCTTGACGCCGAGTCCGAGTTCGTC
TTCCACGACGGGGCTGTCCTCATCGGCCGATATCGTTGGGTTCGCTCCACGGACGAGACGCAGGTAGAGGTGCGG
GCAGATTTCCCGAGCCGTCTGGTCGTTGGCAGGTATGGGCAGGTCGATTCGATGCGCTGGGTTCAGTATCCTCGG
CCTGCGCTTGAAGCTCACGAAGTGGAGCTGGACGTGCGCTGTGTAGGCCTCAACTTTAGGGACCTTCTCCTGGCA
ATGGGCATCGTCGACGACCGGAAGGACAGCATGGGAGTCGAGGCTGCTGGGGTCATTGCACGCGTCGGATCGGCA
GTCCGTCACGTTAAGGCGGGCGACCGTGTCATGGCCATATTTAACAGCTGTTTCTCAACGCGGACGGCCATCCCC
GCGCAGCTGGTTGCCCTGATCCCGGAAGACCTTGGCTTCGAGGACGCGGCAACCATGTCTTCGTCTATCTTGGTC
CAGTCCGCCTGCGGCGGTGTCGGGCTGGCGGCCCTCCAAATTTGCAAGACGGTCGGGGCTCAAGTCTATGCCACT
GTGGGAAGCGAGGAAAAGATACAGCATCTGGTGGACAACTACGGCATTACACGCGACCGCATCTTCTCCTCCCGC
GACTCCTCATTCTTACAGGGCATCATGCAGGCGACAAACGGCCGCGGAGTCGACATGGTGCTAAACTCACTCTCC
GGCGAGCTTCTTCAAGCGGCGTGGCAGTGCGTCGCCAAGCACGGCAAGATGATGGAGATCGGGAAGCGGGACTTT
ATCGGTCGCGGGCAGCTCATGCTCGATCCCTTCGAGGCCAACCGCTCCTTTTACGGAGTCGACCTGTACACCATC
CTTACAGACCGCCCGGAGCTTTCATGCCAGCTGCTTAATCAGTGCATCCGCTACTACAAGGAAGGACACATCAAG
CCCATTCGGCCGATTCAAGTCTTCCCGGCCCAGAGAGCGGCGGACGCATTCCGCATCATGCAAAGGGGGCAGCAT
CTAGGGAAGCTGGTCATCTCGATGCCTGGTCTGGAAGAGACCAAGCAGATGACGACGACTGCGTTCGCGAGGCCC
GGAGCGGCGCTCTCTGACAATTTCACCTATTTCATGGTCGGGGGGCTCGGTGGCCTGGGCAAGGCCGTCACCAGG
TGGATGGTCGAGCGAGGTGCCAGACACTTTGTCTTCTTGTCTCGCTCCGCCGGCCAGACAAGTGAGGACCAAGAG
TTCCTCCAAGAGCTGGAGTCTCAGGGCTGCCACGCCGTTGCCGTGGCCGGCAGCGTTGTCGAGCAGGCAGATGTC
GAGCGCGCGATTCAGGCCGCAACAACGCCTATAGCCGGCGTTGTCCACCTGTCTATGGTGCTAAGGGACGGGCCT
CTGTTCGAGATTGATCACGCAAACTGGGCTCACGTCACAGGGCCCAAAGTGATCGGGGCTTGGAATATCCACAAC
GCACTCGCCAACTCCAAGCTCGACTTTTTCATCCTCTTCAGCTCCGTCGCCGCCGCGGTTGGTCAACCCGGGCAA
GCCAACTATTCCGCCGCCAATTCCTTTCTGGAGTCCTTTGCACAGTACCGCCGCGGCCTTGACCTGCCCTGCTCC
GTCATCTCCCTAGGCGTTATGCAGGACATTGGCTACATTAGCGGGAGTTCTAGGCTGCGGAACCAGGTCCGCAGC
ACGTCGTCACACATAATTCAAGAGGGCGATCTGATCGAGGCCATGGATATCATCATCCACCAATCTCGGCCCTCT
TGCGCCTCTACCGGCGGGCCTCACGCGGCCTATATGTATTGCAACATGGGACAGCTCATGGTGGGGTTGCGGTCG
ACGAAGCCGCTGTCCGATCCCGGAAACCGCACCATATGGAAGCGAGACGTGCGCATGAGTCGCTACCACCGGCTA
GAGGTGGCCGACGAGCGCGGAACCGGCCCGCAGGGCAACCAACTCGATATGCTGCTCGACTCAGTCGCCTTGAAC
CCGGGCGTGCTATGCAACCCGGAGACGCTCGAGGTGATTACGTGGGGGATTGGCCGCATGTGCTGCCAAATGATG
ATGTGGCCCAAGGAGAACCTGGATGTGAACATGAGCATAGTCACGATGGGCGTCGACTCACTAGTGAGCATCGAG
ATCCGAAACTGGTGGCGGCGGACGTTTGGGGTTGAAACTAGCACCCTTAAGATCTTGGGGGCCGGGACGATTGAG
AATCTGGGAGCCATGGCCCTGGCTTCGCTCAAGGAAAAGCATGACGTCAAGGAAGATTTGGACCAGGAATGA
Gene >Hirsu2|5151
CTGCATTTCGGGCTAAGCCAAAAGGTCATTGTCGACTCGGCCGCATCGTTCGGAGTGGCCGGCACCGCCGCAGCA
TCGACGGCCGTGACCGGGCATCCGGAGGAGGAGCATGGCTCCGGCGCGGAGGTTGACAAGCAGCTCGAGACGCTC
GTCAACGGCGACGGGGCCAAGGCTGGCAAGACGACCAAGGAGCAAGTGTCGCGTCTGCTCCCCGTGTCGGCGAAC
AACGACACGTCCCTGCAGTCGCGGGTCCGGGCCCTGCAGGCGTACATCCACAGCCGGTCCGCTCCGTTGGCGGGC
ATCGCGTACACGCTCGGGAGTCGCCGCCAGCATCTGTCCCACAGAACATTCGTCGTTGCCAGGGACGGTGCAGGA
CTTCCTGAGTTTGGACAGTTGCAAAAGGCCAGCCCGTCTGCCCCGTGTGTTGCGTTTGTCTTCACGGGGCAGGGA
GAGCAGTGGTTCGGCATGGGCAAGGAGCTCATTCACAACTCGCCCTCGTTCGAGGCGGATATTCGAAGCATGGAC
ATGGCTCTTCAGAGCCTCCATGACCCACCGTCCTGGTCCATCCAAGGTTTGTCACCCGTCTCGACGGAATAGTCG
CCTAGGCTAACTGCCATCCGCCGTCAAGGCTTTCTCCGCTGCGAGCAGCCCGAGCATCTCGTCCACCGGGCTGAG
TACTCACAGCCCCTATGTACGGCCCTGCAGGTCGCCTTAGTCAACCTCCTCGCCAAGTGCGGCATCTCTCCTGGC
GCCGTCGTCGGCCACTCGAGCGGAGAGATAGCCGGCGCGTACGCCGCCGGGACAATAACCATGGCAGAGGCCATC
TCGGTCGCCTATTACCGCGGCCTGGCAGCCAAGAGCCAGGCTCGCCAGGGCTGCATGGCTGCCGTGGGCCTGGGC
CGCGAAGCTGTCTCGCCTCTGCTCGCCGACGGAGCTGTGGTCGCATGCGAGAACAGTCCGGGCAGCATAACTATT
TCGGGCGACGTCGAGGCCGTTGAGCGGACTCTTGAGCTGATCAAGTACAAGAATCCGGAAGCCCTCGCTCGGAAG
CTGTCTGTTGACAAGGCATACCACTCACGTGAGACGACCACGTGACCAATACAACCACACTTCGTCGCTAACCTG
CCTCCAGATCACATGCGTGAAGTGGGACAAGCATACGAGGCCTCGCTCCTCCAGAAACCGATTCTTCCTGAGCAG
CCGAGAGTCCGCTTCTACTCGAGCCTGACGGGCCAGCGGGCTGAGGAAGATGTCCTCTTCGGGCCGGCCTACTGG
AGGCAAAACCTCGAGTCGCCGGTGCTCTTCAGAGACGCGGTGGAGGCTCTGCTGGACGACTTGGGCCAGTCGCCG
CTGTTCCTCGAGGTTGGCCCGCATGGCGCCTTGCGAGAACCGGTTCGCCAGACGGTTGCCGGCCGCTCGACCGAG
AACATGGCCTACATAACGACGCTGACCAGGGGCAGCGACTGCTTCGTCGACACGCTCGCGGCGCTGGGTCGATTG
TATGCCCACGGCTGTGATGTAAACTTCGCCTTCCTGAACCCGCCGGCCCCAGTCCTGACGGATCTGCCGGCTTAT
CCATGGGACCACAGCCAGAAGTTCTGGACTGAAGACCGCCTCACGCGCGCCTGGAGATACAAACAGGAGAGGCAT
CACGAGATGCTCGGATCAAGGTGTCTGGAGAGCAGCGATATCGAAGTCTCCTGGAGAAACGTGCTCGAGGCCTCG
GATGTGCCCTGGCTTGGGGACCACAAGATCGTAAACGACATCATCTTCCCCTGCGCCGGATATGTCGCGATGATG
GGCGAGGCCATCAGACAGACGACCGGCTCCGAGTCTTATACTCTGCGAAACATGGTCGTCAAAGCAGCCCTGATG
TTTGAGGCGTCCGAGACTGTAGAGCTGATGACGAGGATGAAACCGGTGCGACTGACGGACAGTGCCAACTCTTCT
TGGTCGGACTTGTCCATCATGGCTTTGCGAAAAGGCACTTGGGCGGAGCACTGCGTCGCGCAGGGAAAGGCGGGC
CAGCAGAAGACGCTGCCGCGAAGGGAGCCCGTGCACTATCCTCGCCGGGTGGGCAAGGCATCGTGGTATGAGCGG
CTGGCGCAGCTGGGCCTCAAATACGGGCCGCGGTTTCGCGGCATGCAGCGCATCTCCTCCCACACGACCGAGACG
AGGGCCGTGGCAGAGATCGAGACGGAGACGCATGCTCGGGAGGCGCGGTACGCCGTACACCCGACCGCTCTGGAC
GCCTGCCTGCAGCTCTTCACCGTTTCCATCGCGAGGGGGCTCTCCCGCCACATGGTGACGCTCTGCGTCCCTTCT
GCCATGGGTAGCATCAGCATCAAGCCCGCGGACAGCCGTCTCAAGGCCGAGGCCGTCGCCTCTGCAACCCCTAGG
GGGGGCATCAAGGGAGATGTAGCTGTGGTCGCCGGGGCGGACGATGTGGTTGTACAGATCCAAGACGCCATCTTC
CGTCCGCTGGATAGCCCAGACTCGGTGGAAGACTCGGCGCCTCCTTCCAACGCCCGTCTGGAGTGGCGTCCAGAC
GTGGACTTTGTCGATCTCGGCAGCACGATACGAAGGACGACCGACAAGCGCAAGGCCAAGATATGGCTTCAGCGA
GTCACCGCCTTGTGCATCCTGCGGGCTCTCGACGCGCTTCAGTCATTGGACGTGCCGGCGGGATACCTGGCCAAG
TACGTGGACTGGCTGCGGATCGAGAAGAGGTGCATGCTCGACGATGAATGGGCCTTTATGGTCCCCGAGGCGCGG
TCGTGGGCGGAGCTGGCTCCCGGGAGCATCGAGACCTTGATGCCCGCCATCCTCGGCGACTTCGGCAGCGTCTGG
GACCCAAATACACGGAGATGCACGCAGTTGCTCCTCAAGATGTCGACCCCTGACAACATTCGAGCCGTCTTCCAG
GACGATATGCACCCCTTGAATCTAATGATGGAGGACAGCTTGCTCGAGAGCATATACACCTTTCACACAGATTTG
AGGGACACGGGCGAGCTCATCTCCCTCTGCGCTCACGCCCAGCCGATGATGAAGGTGCTCGAAGTGGGAGCTGGT
ACCGCAACGTCCACACTGAACGTACTCAAGGCCCTGGTGTCAGACGACGGCACGTGCATGTACTCGCAATACATC
TTTACCGACATCTCGGCGGGCTTCTTTGCCGCGGCCGCGGACAAGCTCAGGCAGTACCCAAATATCGACTACAAG
GTGTTCGACATCGCCAAGGATCCGGCCAAGCAGGGCTTTGAGCCGGCATCCTACGACCTCATCCTGGCCGACAAC
GTGAGGTCCGGTTCTCGCCTGGCGAGGACAGAATGCTGATAATTGCAGGTTGTTCATGTTGCCCCGTCGCTGCAG
GAGGCCCTTCGCAACCTTCGCCTGCTCCTCCGTCCAGGCGGCCGACTCGTTCTGGGGGAGTTGGTCCATCGTAGG
CGCCCGTGAATCCTAGGAAAGGGGCTCCGGTGCTGACTTTTGGCCCATAGGAGCGACATTTAAAGTCACCCGTTT
CGCCACGGTAGGTTGTCTGTATCCGTGATTTCTGCCATGAACTGCACCCGGCCACTCCATATACTGATCCACAAC
TGCAGGGCCTTTTGCCTGGCTGGTGGGCTGGCGAAGCTGACGGCCGTCACGACGGGCCACTCGTCTCGGCGGAGC
GCTGGGATGATGAGCTTCGGCTGGCAGGCTTCTCTGGAACCGGCACGGTCTTCCTGGACGACGACTCACCCTACC
AGGTCAGCTTCGTGATGGCCTCCACGGCGGTCGAGGCCCGCAAGGCCGATGTCGGCCTCAGTGATGTCACGTTTC
TGTACCGCGGCTTTAAGCACGAGTTTGCCCTCGAGCTGGCGGCTAGGCTCGCGCAGGAGGGCATCGACATCCACT
GGAGCCAGATCGGCAGCAACGAAGCCATCGACGGACGAGACGTCGTCTCGACGGTCGATCTGGAAGGCCCCTATC
TGCACGACATCTCCAAGACCGACTACGACAGGCTTGTGGCTCACCTATCGAAGCTCACGTCCAGCACGCTATGGC
TCACGCGCGCGGCTCAGGTGGAAAGCGTTGATCCTCGCTACGGGCTGACCATCGGCCTGGCGCGCACCATACGCA
CAGAGCTCGGACTCCGATTTTCCACGCTCGAGCTTCAGTCCCTCGGGCCTGACGCTGTAGATGCTTCCGCGGCTG
TCTTTCACAAGCTTCGACGCCCTAGCCCATCCGCCCATCTTGACGCCGAGTCCGAGTTCGTCTTCCACGACGGGG
CTGTCCTCATCGGCCGATATCGTTGGGTTCGCTCCACGGACGAGACGCAGGTAGAGGTGCGGGCAGATTTCCCGA
GCCGTCTGGTCGTTGGCAGGTATGGGCAGGTCGATTCGATGCGCTGGGTTCAGTATCCTCGGCCTGCGCTTGAAG
CTCACGAAGTGGAGCTGGACGTGCGCTGTGTAGGCCTCAACTTTAGGGTAAGTTCTGGCCAGTCGATGACGAGCC
AGCCATCCAGATTCACTCACACCTTACAGGACCTTCTCCTGGCAATGGGCATCGTCGACGACCGGAAGGACAGCA
TGGGAGTCGAGGCTGCTGGGGTCATTGCACGCGTCGGATCGGCAGTCCGTCACGTTAAGGCGGGCGACCGTGTCA
TGGCCATATTTAACAGCTGTTTCTCAACGCGGACGGCCATCCCCGCGCAGCTGGTTGCCCTGATCCCGGAAGACC
TTGGCTTCGAGGACGCGGCAACCATGTCTTCGGTTTACATCACAGCCATCCACTGCATCATCAACCTGGGGCAGT
TGAAAAGGGGCCAGGAAAGTCATTTCTCGAGCTGATATCTCCTCTAGACCGCAGTTCAAGAGCTAACATGGGTCT
TTGAAATAGTCTATCTTGGTCCAGTCCGCCTGCGGCGGTGTCGGGCTGGCGGCCCTCCAAATTTGCAAGACGGTC
GGGGCTCAAGTACGTAACGTCACGGAACAAGGACGATGGAATTCGGGATCGGTGCCTAATATAAACCCAAGGTCT
ATGCCACTGTGGGAAGCGAGGAAAAGATACAGCATCTGGTGGACAACTACGGCATTACACGCGACCGCATCTTCT
CCTCCCGCGACTCCTCATTCTTACAGGGCATCATGCAGGCGACAAACGGCCGCGGAGTCGACATGGTGCTAAACT
CACTCTCCGGCGAGCTTCTTCAAGCGGCGTGGCAGTGCGTCGCCAAGCACGGCAAGATGATGGAGATCGGGAAGC
GGGACTTTATCGGTCGCGGGCAGCTCATGCTCGATCCCTTCGAGGCCAACCGCTCCTTTTACGGAGTCGACCTGT
ACACCATCCTTACAGACCGCCCGGAGCTTTCATGCCAGTAAGCCACACGATATGCATGATATGTAGCTGTCTGGC
TGACTCCAAGTCCAGGCTGCTTAATCAGTGCATCCGCTACTACAAGGAAGGACACATCAAGCCCATTCGGCCGAT
TCAAGTCTTCCCGGCCCAGAGAGCGGCGGACGCATTCCGCATCATGCAAAGGGGGCAGCATCTAGGGAAGCTGGT
CATCTCGATGCCTGGTCTGGAAGAGACCAAGCAGATGACGACGACTGCGTTCGCGAGGCCCGGAGCGGCGCTCTC
TGACAATTTCACCTATTTCATGGTCGGGGGGCTCGGTGGCCTGGGCAAGGCCGTCACCAGGTGGATGGTCGAGCG
AGGTGCCAGACACTTTGTCTTCTTGTCTCGCTCCGCCGGCCAGACAAGTGAGGACCAAGAGTTCCTCCAAGAGCT
GGAGTCTCAGGGCTGCCACGCCGTTGCCGTGGCCGGCAGCGTTGTCGAGCAGGCAGATGTCGAGCGCGCGATTCA
GGCCGCAACAACGCCTATAGCCGGCGTTGTCCACCTGTCTATGGTGCTAAGGGTATATTCCATGACGACCGGCTT
CAAGGAGACTCGCTGTCCGCTAACCGGGAATCAGGACGGGCCTCTGTTCGAGATTGATCACGCAAACTGGGCTCA
CGTCACAGGGCCCAAAGTGATCGGGGCTTGGAATATCCACAACGCACTCGCCAACTCCAAGCTCGACTTTTTCAT
CCTCTTCAGCTCCGTCGCCGCCGCGGTTGGTCAACCCGGGCAAGCCAACTATTCCGCCGCCAATTCCTTTCTGGA
GTCCTTTGCACAGTACCGCCGCGGCCTTGACCTGCCCTGCTCCGTCATCTCCCTAGGCGTTATGCAGGACATTGG
CTACATTAGCGGGAGTTCTAGGCTGCGGAACCAGGTCCGCAGCACGTCGTCACACATAATTCAAGAGGGCGATCT
GATCGAGGCCATGGATATCATCATCCACCAATCTCGGCCCTCTTGCGCCTCTACCGGCGGGCCTCACGCGGCCTA
TATGTATTGCAACATGGGACAGCTCATGGTGGGGTTGCGGTCGACGAAGCCGCTGTCCGATCCCGGAAACCGCAC
CATATGGAAGCGAGACGTGCGCATGAGTCGCTACCACCGGCTAGAGGTGGCCGACGAGCGCGGAACCGGCCCGCA
GGGCAACCAACTCGATATGCTGCTCGACTCAGTCGCCTTGAACCCGGGCGTGCTATGCAACCCGGAGACGCTCGA
GGTGATTACGTGGGGGATTGGCCGCATGTGCTGCCAAATGATGATGTGGCCCAAGGAGAACCTGGATGTGAACAT
GAGCATAGTCACGATGGGCGTCGACTCACTAGTGAGCATCGAGATCCGAAACTGGTGGCGGCGGACGTTTGGGGT
TGAAACTAGCACCCTTAAGATCTTGGGGGCCGGGACGATTGAGAATCTGGGAGCCATGGCCCTGGCTTCGCTCAA
GGAAAAGCATGACGTCAAGGAAGATTTGGACCAGGAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail