Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5144
Gene name
LocationContig_2579:380..2016
Strand-
Gene length (bp)1636
Transcript length (bp)1416
Coding sequence length (bp)1416
Protein length (aa) 472

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14630 ORC5_C Origin recognition complex (ORC) subunit 5 C-terminus 1.9E-76 178 469
PF13191 AAA_16 AAA ATPase domain 2.1E-09 20 102

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O43114|ORC5_SCHPO Origin recognition complex subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=orc5 PE=1 SV=2 23 469 1.0E-29
sp|Q24169|ORC5_DROME Origin recognition complex subunit 5 OS=Drosophila melanogaster GN=Orc5 PE=1 SV=1 20 471 3.0E-25
sp|Q9WUV0|ORC5_MOUSE Origin recognition complex subunit 5 OS=Mus musculus GN=Orc5 PE=2 SV=1 23 471 4.0E-22
sp|O43913|ORC5_HUMAN Origin recognition complex subunit 5 OS=Homo sapiens GN=ORC5 PE=1 SV=1 23 471 2.0E-18

GO

GO Term Description Terminal node
GO:0005634 nucleus Yes
GO:0000808 origin recognition complex Yes
GO:0006260 DNA replication Yes
GO:1901360 organic cyclic compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0008150 biological_process No
GO:0043226 organelle No
GO:0071704 organic substance metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0043229 intracellular organelle No
GO:0044260 cellular macromolecule metabolic process No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:0043227 membrane-bounded organelle No
GO:0032991 protein-containing complex No
GO:0006259 DNA metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0110165 cellular anatomical entity No
GO:0006725 cellular aromatic compound metabolic process No
GO:0005575 cellular_component No
GO:0044237 cellular metabolic process No
GO:0043231 intracellular membrane-bounded organelle No
GO:0043170 macromolecule metabolic process No
GO:0090304 nucleic acid metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.23 0.5962 0.0776 0.2049 0.2439 0.0034 0.13 0.0666 0.0785 0.0048

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5345
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2445
Ophiocordyceps australis map64 (Brazil) OphauB2|2514
Ophiocordyceps camponoti-floridani Ophcf2|04294
Ophiocordyceps kimflemingae Ophio5|4798
Ophiocordyceps subramaniannii Hirsu2|5144 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5144
MASCYRFPDEIILAPVLQSFPGREHQIRALATLFHPDAARCRSLVVYGTEATGKSAVTEKLLVRLARPMGGQDAH
VETLRFAIINSTQCITARHLFETIVRAVSNGLGHHDKNGRARRPPHRRFVLVLDAIDRQRDAPPTLLPALARLSE
MIPCLTCVFIITCPPAGVLRAQTSAHLHFPPYTKPEFVRIQSLTPPDPIPGTTQQETAEVWTRFCASVHDALVRS
ATRTLSSFQCSCRTLWPQFTAPVTAGTHAVREFSKLLVAARVHFQDESLPNPSIVSSHPDSGSKPKTTPMVSGLT
KLAQPATNAGAAELTGLLPIDARLLLLSAYLASHNATRNDRTLFSTYHHGRRRRRGGGFVTAVGVYRRTARKHRK
IARKLLGAHAFVLERMLAIFEAVRGEWAPEDNIGVAGLDGDVGMAIATLASLRLLVRVGSGDVTDRAGKWRINAS
WEAVRSIGRSMGVEVEDWLIE*
Coding >Hirsu2|5144
ATGGCCTCTTGCTATCGTTTTCCAGACGAGATTATCCTCGCACCGGTATTGCAGAGCTTTCCCGGACGGGAACAT
CAGATTCGCGCTCTCGCTACCTTGTTTCATCCCGATGCTGCCCGATGCCGGAGCCTAGTCGTTTACGGCACAGAA
GCAACGGGCAAGTCAGCGGTTACAGAGAAGCTTCTCGTGCGGCTCGCGAGACCGATGGGCGGTCAAGATGCGCAT
GTCGAAACGCTCCGATTTGCAATTATCAATTCCACTCAGTGCATCACGGCGCGACACCTTTTTGAGACCATTGTT
CGGGCTGTATCTAATGGATTGGGGCACCACGACAAGAACGGACGTGCTCGGAGGCCTCCGCACCGGCGCTTCGTC
CTGGTGCTAGACGCAATAGACAGGCAGAGAGACGCGCCACCCACCTTGCTGCCGGCATTGGCTCGCCTGTCCGAG
ATGATCCCATGTCTGACATGTGTTTTCATCATCACCTGCCCCCCGGCCGGAGTCCTGCGTGCGCAAACGTCGGCT
CATCTCCATTTTCCTCCCTATACGAAACCCGAGTTCGTCCGCATACAGTCACTTACACCGCCCGATCCAATTCCT
GGCACCACGCAGCAGGAGACGGCAGAAGTATGGACACGGTTCTGCGCCTCCGTCCACGATGCTCTCGTGCGTTCT
GCGACTCGTACCCTCTCCTCGTTTCAATGTAGCTGCCGTACCCTCTGGCCGCAATTCACGGCTCCTGTCACCGCC
GGTACACATGCCGTCAGGGAGTTCTCCAAGCTGCTCGTCGCCGCCAGGGTTCATTTTCAGGACGAATCGCTGCCG
AATCCGAGTATCGTCTCTTCCCACCCTGACAGTGGCTCGAAGCCGAAGACCACGCCCATGGTCAGCGGCCTGACC
AAGCTGGCTCAGCCTGCTACTAATGCCGGGGCCGCCGAGCTCACAGGCCTTCTCCCGATTGACGCTCGGCTGCTC
CTCCTGTCGGCCTATCTAGCCTCCCACAACGCCACCCGTAATGATCGCACCCTCTTCTCGACCTATCACCATGGC
CGCAGGCGCCGTCGAGGCGGCGGATTTGTTACCGCTGTCGGGGTCTACCGGAGGACTGCACGCAAACATCGCAAG
ATCGCCCGCAAGTTACTTGGAGCGCATGCCTTCGTCCTCGAGCGCATGTTAGCTATCTTTGAAGCTGTACGCGGC
GAGTGGGCGCCGGAGGACAATATAGGCGTGGCGGGACTGGACGGCGATGTGGGCATGGCGATCGCGACGCTGGCT
AGCCTAAGGCTCCTAGTTAGAGTTGGTTCAGGAGACGTCACGGATAGAGCAGGCAAATGGAGAATAAACGCCAGT
TGGGAGGCTGTGAGGAGCATAGGACGAAGCATGGGTGTCGAAGTCGAGGATTGGCTTATTGAGTAA
Transcript >Hirsu2|5144
ATGGCCTCTTGCTATCGTTTTCCAGACGAGATTATCCTCGCACCGGTATTGCAGAGCTTTCCCGGACGGGAACAT
CAGATTCGCGCTCTCGCTACCTTGTTTCATCCCGATGCTGCCCGATGCCGGAGCCTAGTCGTTTACGGCACAGAA
GCAACGGGCAAGTCAGCGGTTACAGAGAAGCTTCTCGTGCGGCTCGCGAGACCGATGGGCGGTCAAGATGCGCAT
GTCGAAACGCTCCGATTTGCAATTATCAATTCCACTCAGTGCATCACGGCGCGACACCTTTTTGAGACCATTGTT
CGGGCTGTATCTAATGGATTGGGGCACCACGACAAGAACGGACGTGCTCGGAGGCCTCCGCACCGGCGCTTCGTC
CTGGTGCTAGACGCAATAGACAGGCAGAGAGACGCGCCACCCACCTTGCTGCCGGCATTGGCTCGCCTGTCCGAG
ATGATCCCATGTCTGACATGTGTTTTCATCATCACCTGCCCCCCGGCCGGAGTCCTGCGTGCGCAAACGTCGGCT
CATCTCCATTTTCCTCCCTATACGAAACCCGAGTTCGTCCGCATACAGTCACTTACACCGCCCGATCCAATTCCT
GGCACCACGCAGCAGGAGACGGCAGAAGTATGGACACGGTTCTGCGCCTCCGTCCACGATGCTCTCGTGCGTTCT
GCGACTCGTACCCTCTCCTCGTTTCAATGTAGCTGCCGTACCCTCTGGCCGCAATTCACGGCTCCTGTCACCGCC
GGTACACATGCCGTCAGGGAGTTCTCCAAGCTGCTCGTCGCCGCCAGGGTTCATTTTCAGGACGAATCGCTGCCG
AATCCGAGTATCGTCTCTTCCCACCCTGACAGTGGCTCGAAGCCGAAGACCACGCCCATGGTCAGCGGCCTGACC
AAGCTGGCTCAGCCTGCTACTAATGCCGGGGCCGCCGAGCTCACAGGCCTTCTCCCGATTGACGCTCGGCTGCTC
CTCCTGTCGGCCTATCTAGCCTCCCACAACGCCACCCGTAATGATCGCACCCTCTTCTCGACCTATCACCATGGC
CGCAGGCGCCGTCGAGGCGGCGGATTTGTTACCGCTGTCGGGGTCTACCGGAGGACTGCACGCAAACATCGCAAG
ATCGCCCGCAAGTTACTTGGAGCGCATGCCTTCGTCCTCGAGCGCATGTTAGCTATCTTTGAAGCTGTACGCGGC
GAGTGGGCGCCGGAGGACAATATAGGCGTGGCGGGACTGGACGGCGATGTGGGCATGGCGATCGCGACGCTGGCT
AGCCTAAGGCTCCTAGTTAGAGTTGGTTCAGGAGACGTCACGGATAGAGCAGGCAAATGGAGAATAAACGCCAGT
TGGGAGGCTGTGAGGAGCATAGGACGAAGCATGGGTGTCGAAGTCGAGGATTGGCTTATTGAGTAA
Gene >Hirsu2|5144
ATGGCCTCTTGCTATCGTTTTCCAGACGAGATTATCCTCGCACCGGTATTGCAGAGCTTTCCCGGACGGGAACAT
CAGATTCGCGCTCTCGCTACCTTGTTTCATGTATGAGACTCCCCTCATATTGGCCCTCGTTTAACGCCATCGTGG
GTCACTGACCAGCGGCACTGCTGTAGCCCGATGCTGCCCGATGCCGGAGCCTAGTCGTTTACGGCACAGAAGCAA
CGGGCAAGTCAGCGGTTACAGAGAAGCTTCTCGTGCGGCTCGCGAGACCGATGGGCGGTCAAGATGCGCATGTCG
AAACGCTCCGATTTGCAATTATCAATTCCACTCAGTGCATCACGGCGCGACACCTTTTTGAGACCATTGTTCGGG
CTGTATCTAATGGATTGGGGCACCACGACAAGAACGGACGTGCTCGGAGGTGCGAGACGTTGGCCCAGCTGTCGG
TGTTGCTGGCGACAATGCTCAATGCCGCGATCAGGCCTCCGCACCGGCGCTTCGTCCTGGTGCTAGACGCAATAG
ACAGGCAGAGAGACGCGCCACCCACCTTGCTGCCGGCATTGGCTCGCCTGTCCGAGATGGTAAGGATGACCCTTG
GACGAGAAATTGACAACTGCTTCTTTCGGAAGATTTTCAAAGCTAATTGTAGATATTCGATTCATCCCTACAGAT
CCCATGTCTGACATGTGTTTTCATCATCACCTGCCCCCCGGCCGGAGTCCTGCGTGCGCAAACGTCGGCTCATCT
CCATTTTCCTCCCTATACGAAACCCGAGTTCGTCCGCATACAGTCACTTACACCGCCCGATCCAATTCCTGGCAC
CACGCAGCAGGAGACGGCAGAAGTATGGACACGGTTCTGCGCCTCCGTCCACGATGCTCTCGTGCGTTCTGCGAC
TCGTACCCTCTCCTCGTTTCAATGTAGCTGCCGTACCCTCTGGCCGCAATTCACGGCTCCTGTCACCGCCGGTAC
ACATGCCGTCAGGGAGTTCTCCAAGCTGCTCGTCGCCGCCAGGGTTCATTTTCAGGACGAATCGCTGCCGAATCC
GAGTATCGTCTCTTCCCACCCTGACAGTGGCTCGAAGCCGAAGACCACGCCCATGGTCAGCGGCCTGACCAAGCT
GGCTCAGCCTGCTACTAATGCCGGGGCCGCCGAGCTCACAGGCCTTCTCCCGATTGACGCTCGGCTGCTCCTCCT
GTCGGCCTATCTAGCCTCCCACAACGCCACCCGTAATGATCGCACCCTCTTCTCGACCTATCACCATGGCCGCAG
GCGCCGTCGAGGCGGCGGATTTGTTACCGCTGTCGGGGTCTACCGGAGGACTGCACGCAAACATCGCAAGATCGC
CCGCAAGTTACTTGGAGCGCATGCCTTCGTCCTCGAGCGCATGTTAGCTATCTTTGAAGCTGTACGCGGCGAGTG
GGCGCCGGAGGACAATATAGGCGTGGCGGGACTGGACGGCGATGTGGGCATGGCGATCGCGACGCTGGCTAGCCT
AAGGCTCCTAGTTAGAGTTGGTTCAGGAGACGTCACGGATAGAGCAGGCAAATGGAGAATAAACGCCAGTTGGGA
GGCTGTGAGGAGCATAGGACGAAGCATGGGTGTCGAAGTCGAGGATTGGCTTATTGAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail