Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5141
Gene name
LocationContig_2575:1643..2271
Strand-
Gene length (bp)628
Transcript length (bp)456
Coding sequence length (bp)456
Protein length (aa) 152

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00036 EF-hand_1 EF hand 4.1E-07 24 48
PF13833 EF-hand_8 EF-hand domain pair 4.5E-07 13 48
PF13833 EF-hand_8 EF-hand domain pair 1.7E-02 56 76
PF13833 EF-hand_8 EF-hand domain pair 2.1E-03 66 111
PF13202 EF-hand_5 EF hand 9.0E-02 28 44
PF13202 EF-hand_5 EF hand 1.5E-03 57 74
PF13202 EF-hand_5 EF hand 1.4E-02 122 137

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P12815|PDCD6_MOUSE Programmed cell death protein 6 OS=Mus musculus GN=Pdcd6 PE=1 SV=2 1 147 2.0E-40
sp|O75340|PDCD6_HUMAN Programmed cell death protein 6 OS=Homo sapiens GN=PDCD6 PE=1 SV=1 1 147 3.0E-40
sp|Q94743|SORCN_SCHJA Sorcin OS=Schistosoma japonicum PE=2 SV=1 2 145 3.0E-39
sp|Q8BFY6|PEF1_MOUSE Peflin OS=Mus musculus GN=Pef1 PE=1 SV=1 2 144 3.0E-33
sp|Q9UBV8|PEF1_HUMAN Peflin OS=Homo sapiens GN=PEF1 PE=1 SV=1 2 144 1.0E-32
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P12815|PDCD6_MOUSE Programmed cell death protein 6 OS=Mus musculus GN=Pdcd6 PE=1 SV=2 1 147 2.0E-40
sp|O75340|PDCD6_HUMAN Programmed cell death protein 6 OS=Homo sapiens GN=PDCD6 PE=1 SV=1 1 147 3.0E-40
sp|Q94743|SORCN_SCHJA Sorcin OS=Schistosoma japonicum PE=2 SV=1 2 145 3.0E-39
sp|Q8BFY6|PEF1_MOUSE Peflin OS=Mus musculus GN=Pef1 PE=1 SV=1 2 144 3.0E-33
sp|Q9UBV8|PEF1_HUMAN Peflin OS=Homo sapiens GN=PEF1 PE=1 SV=1 2 144 1.0E-32
sp|Q5PQ53|PEF1_XENLA Peflin OS=Xenopus laevis GN=pef1 PE=1 SV=1 2 144 5.0E-32
sp|Q641Z8|PEF1_RAT Peflin OS=Rattus norvegicus GN=Pef1 PE=2 SV=1 2 144 2.0E-31
sp|Q6DC93|PEF1_DANRE Peflin OS=Danio rerio GN=pef1 PE=2 SV=1 2 150 4.0E-30
sp|Q6P069|SORCN_MOUSE Sorcin OS=Mus musculus GN=Sri PE=1 SV=1 4 147 9.0E-29
sp|Q5R4U9|SORCN_PONAB Sorcin OS=Pongo abelii GN=SRI PE=2 SV=1 4 147 2.0E-28
sp|P30626|SORCN_HUMAN Sorcin OS=Homo sapiens GN=SRI PE=1 SV=1 4 147 2.0E-28
sp|P05044|SORCN_CRIGR Sorcin OS=Cricetulus griseus GN=SRI PE=1 SV=1 4 147 3.0E-28
sp|Q8VC88|GRAN_MOUSE Grancalcin OS=Mus musculus GN=Gca PE=1 SV=1 4 147 1.0E-25
sp|P28676|GRAN_HUMAN Grancalcin OS=Homo sapiens GN=GCA PE=1 SV=2 4 147 2.0E-23
sp|Q5RAI6|GRAN_PONAB Grancalcin OS=Pongo abelii GN=GCA PE=2 SV=1 4 147 2.0E-22
sp|Q8W4L0|CML49_ARATH Probable calcium-binding protein CML49 OS=Arabidopsis thaliana GN=CML49 PE=2 SV=1 4 148 2.0E-20
sp|P13135|CPNS1_BOVIN Calpain small subunit 1 OS=Bos taurus GN=CAPNS1 PE=2 SV=1 18 143 1.0E-19
sp|Q9FYE4|CML50_ARATH Probable calcium-binding protein CML50 OS=Arabidopsis thaliana GN=CML50 PE=2 SV=1 4 148 5.0E-19
sp|P04574|CPNS1_PIG Calpain small subunit 1 OS=Sus scrofa GN=CAPNS1 PE=1 SV=1 18 143 5.0E-19
sp|P04632|CPNS1_HUMAN Calpain small subunit 1 OS=Homo sapiens GN=CAPNS1 PE=1 SV=1 18 143 3.0E-18
sp|O88456|CPNS1_MOUSE Calpain small subunit 1 OS=Mus musculus GN=Capns1 PE=1 SV=1 18 143 4.0E-18
sp|P06813|CPNS1_RABIT Calpain small subunit 1 OS=Oryctolagus cuniculus GN=CAPNS1 PE=1 SV=1 18 143 6.0E-18
sp|Q96L46|CPNS2_HUMAN Calpain small subunit 2 OS=Homo sapiens GN=CAPNS2 PE=2 SV=2 18 143 1.0E-17
sp|Q64537|CPNS1_RAT Calpain small subunit 1 OS=Rattus norvegicus GN=Capns1 PE=1 SV=3 18 143 2.0E-17
sp|Q9D7J7|CPNS2_MOUSE Calpain small subunit 2 OS=Mus musculus GN=Capns2 PE=2 SV=1 18 144 7.0E-17
sp|P53238|PEF1_YEAST Peflin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEF1 PE=1 SV=2 2 147 1.0E-16
sp|Q9VT65|CANB_DROME Calpain-B OS=Drosophila melanogaster GN=CalpB PE=1 SV=2 4 147 7.0E-16
sp|Q92177|CAN3_CHICK Calpain-3 OS=Gallus gallus GN=CAPN3 PE=2 SV=1 18 143 9.0E-16
sp|Q11002|CANA_DROME Calpain-A OS=Drosophila melanogaster GN=CalpA PE=1 SV=2 18 147 1.0E-15
sp|P06815|CAN1_RABIT Calpain-1 catalytic subunit (Fragment) OS=Oryctolagus cuniculus GN=CAPN1 PE=1 SV=1 18 136 2.0E-13
sp|Q9ZQH1|CML48_ARATH Probable calcium-binding protein CML48 OS=Arabidopsis thaliana GN=CML48 PE=2 SV=2 2 143 3.0E-13
sp|O35350|CAN1_MOUSE Calpain-1 catalytic subunit OS=Mus musculus GN=Capn1 PE=1 SV=1 17 136 3.0E-13
sp|P97571|CAN1_RAT Calpain-1 catalytic subunit OS=Rattus norvegicus GN=Capn1 PE=1 SV=1 17 136 3.0E-13
sp|O08529|CAN2_MOUSE Calpain-2 catalytic subunit OS=Mus musculus GN=Capn2 PE=1 SV=4 18 144 8.0E-13
sp|Q27970|CAN1_BOVIN Calpain-1 catalytic subunit OS=Bos taurus GN=CAPN1 PE=1 SV=3 17 136 8.0E-13
sp|P07384|CAN1_HUMAN Calpain-1 catalytic subunit OS=Homo sapiens GN=CAPN1 PE=1 SV=1 18 136 9.0E-13
sp|P35750|CAN1_PIG Calpain-1 catalytic subunit OS=Sus scrofa GN=CAPN1 PE=2 SV=3 18 136 1.0E-12
sp|Q5NVS7|CAN1_PONAB Calpain-1 catalytic subunit OS=Pongo abelii GN=CAPN1 PE=2 SV=1 18 136 1.0E-12
sp|Q9GLG2|CAN1_MACFA Calpain-1 catalytic subunit OS=Macaca fascicularis GN=CAPN1 PE=2 SV=1 18 136 1.0E-12
sp|Q9GLG7|CAN3_MACFA Calpain-3 OS=Macaca fascicularis GN=CAPN3 PE=2 SV=1 18 143 2.0E-12
sp|P20807|CAN3_HUMAN Calpain-3 OS=Homo sapiens GN=CAPN3 PE=1 SV=2 18 143 2.0E-12
sp|P06814|CAN2_RABIT Calpain-2 catalytic subunit (Fragment) OS=Oryctolagus cuniculus GN=CAPN2 PE=1 SV=1 18 143 3.0E-12
sp|Q64691|CAN3_MOUSE Calpain-3 OS=Mus musculus GN=Capn3 PE=2 SV=2 18 143 3.0E-12
sp|P16259|CAN3_RAT Calpain-3 OS=Rattus norvegicus GN=Capn3 PE=2 SV=1 18 143 3.0E-12
sp|Q92178|CAN2_CHICK Calpain-2 catalytic subunit OS=Gallus gallus GN=CAPN2 PE=2 SV=3 18 143 5.0E-12
sp|Q07009|CAN2_RAT Calpain-2 catalytic subunit OS=Rattus norvegicus GN=Capn2 PE=1 SV=3 18 144 6.0E-12
sp|Q27971|CAN2_BOVIN Calpain-2 catalytic subunit OS=Bos taurus GN=CAPN2 PE=2 SV=2 18 144 7.0E-12
sp|Q9GLG1|CAN2_MACFA Calpain-2 catalytic subunit OS=Macaca fascicularis GN=CAPN2 PE=2 SV=3 18 137 1.0E-11
sp|P17655|CAN2_HUMAN Calpain-2 catalytic subunit OS=Homo sapiens GN=CAPN2 PE=1 SV=6 18 137 2.0E-11
sp|P43368|CAN3_PIG Calpain-3 OS=Sus scrofa GN=CAPN3 PE=2 SV=2 18 144 2.0E-11
sp|P51186|CAN3_BOVIN Calpain-3 OS=Bos taurus GN=CAPN3 PE=2 SV=2 18 144 5.0E-11
sp|Q9TTH8|CAN3_SHEEP Calpain-3 OS=Ovis aries GN=CAPN3 PE=2 SV=1 18 144 5.0E-11
sp|O14815|CAN9_HUMAN Calpain-9 OS=Homo sapiens GN=CAPN9 PE=1 SV=1 23 143 7.0E-11
sp|A6NHC0|CAN8_HUMAN Calpain-8 OS=Homo sapiens GN=CAPN8 PE=2 SV=3 18 147 8.0E-11
sp|P43367|CAN2_PIG Calpain-2 catalytic subunit (Fragment) OS=Sus scrofa GN=CAPN2 PE=2 SV=2 18 137 1.0E-10
sp|P00789|CANX_CHICK Calpain-1 catalytic subunit OS=Gallus gallus PE=1 SV=2 18 143 2.0E-10
sp|Q38872|CDPK6_ARATH Calcium-dependent protein kinase 6 OS=Arabidopsis thaliana GN=CPK6 PE=1 SV=1 20 148 3.0E-10
sp|Q4V8Q1|CAN11_RAT Calpain 11 OS=Rattus norvegicus GN=Capn11 PE=2 SV=2 18 144 4.0E-10
sp|P27730|CAN_SCHMA Calpain OS=Schistosoma mansoni PE=2 SV=1 15 143 1.0E-09
sp|Q78EJ9|CAN8_RAT Calpain-8 OS=Rattus norvegicus GN=Capn8 PE=2 SV=1 18 147 1.0E-09
sp|A5A7I7|CDPK4_SOLTU Calcium-dependent protein kinase 4 OS=Solanum tuberosum GN=CPK4 PE=2 SV=1 20 135 2.0E-09
sp|Q9D805|CAN9_MOUSE Calpain-9 OS=Mus musculus GN=Capn9 PE=2 SV=2 23 144 2.0E-09
sp|O35920|CAN9_RAT Calpain-9 OS=Rattus norvegicus GN=Capn9 PE=2 SV=2 23 144 6.0E-09
sp|Q91VA3|CAN8_MOUSE Calpain-8 OS=Mus musculus GN=Capn8 PE=1 SV=1 18 147 1.0E-08
sp|Q6J756|CAN11_MOUSE Calpain-11 OS=Mus musculus GN=Capn11 PE=1 SV=1 18 144 2.0E-08
sp|Q95YL4|PEFB_DICDI Penta-EF hand domain-containing protein 2 OS=Dictyostelium discoideum GN=pefB PE=1 SV=1 2 141 2.0E-08
sp|A5A7I8|CDPK5_SOLTU Calcium-dependent protein kinase 5 OS=Solanum tuberosum GN=CPK5 PE=2 SV=1 20 135 3.0E-08
sp|Q95YL5|PEFA_DICDI Penta-EF hand domain-containing protein 1 OS=Dictyostelium discoideum GN=pefA PE=1 SV=1 2 138 4.0E-08
sp|Q9SZM3|CDPKQ_ARATH Calcium-dependent protein kinase 26 OS=Arabidopsis thaliana GN=CPK26 PE=2 SV=1 20 135 6.0E-08
sp|Q38871|CDPK5_ARATH Calcium-dependent protein kinase 5 OS=Arabidopsis thaliana GN=CPK5 PE=2 SV=1 20 135 7.0E-08
sp|Q21153|CMC1_CAEEL Probable calcium-binding mitochondrial carrier K02F3.2 OS=Caenorhabditis elegans GN=K02F3.2 PE=3 SV=3 19 150 4.0E-07
sp|Q38869|CDPK4_ARATH Calcium-dependent protein kinase 4 OS=Arabidopsis thaliana GN=CPK4 PE=1 SV=1 20 138 5.0E-07
sp|Q948R0|CML5_ORYSJ Calmodulin-like protein 5 OS=Oryza sativa subsp. japonica GN=CML5 PE=2 SV=1 27 112 8.0E-07
sp|Q41420|CALM3_SOLTU Putative calmodulin-3 (Fragment) OS=Solanum tuberosum GN=PCM3 PE=5 SV=1 27 112 9.0E-07
sp|P28583|CDPK_SOYBN Calcium-dependent protein kinase SK5 OS=Glycine max PE=1 SV=1 20 135 9.0E-07
sp|Q9ZSA4|CDPKR_ARATH Calcium-dependent protein kinase 27 OS=Arabidopsis thaliana GN=CPK27 PE=1 SV=3 55 136 3.0E-06
sp|Q39016|CDPKB_ARATH Calcium-dependent protein kinase 11 OS=Arabidopsis thaliana GN=CPK11 PE=1 SV=2 20 138 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005509 calcium ion binding Yes
GO:0046872 metal ion binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0043169 cation binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5141
MLSERELSDALVNGDWTAFDIQTVRMMIRMFDSDRNGTIGFDEFCGLWSFLASWRTLFDRFDVDRSGNISLAEFT
DALIAFRYRLSPAFVELLFRTYDKRNEGVMSFDLFVQSCISLKRMTDVFKKYDDDRDGYITLSFEDFLSEILKQL
K*
Coding >Hirsu2|5141
ATGCTGTCGGAGAGGGAGCTGTCGGACGCGCTGGTCAACGGCGACTGGACGGCGTTCGACATCCAGACGGTGCGG
ATGATGATCCGCATGTTCGACTCGGACCGCAACGGCACCATCGGCTTCGACGAGTTCTGCGGGCTGTGGTCCTTC
CTGGCCTCGTGGCGCACCCTGTTCGACCGGTTCGACGTCGACCGGTCCGGCAACATCTCGCTCGCCGAGTTCACC
GACGCTCTCATCGCCTTCCGCTACCGCCTCAGCCCGGCCTTTGTCGAGCTGCTGTTCCGCACCTACGACAAGCGC
AACGAGGGCGTCATGAGCTTCGACCTCTTCGTCCAGAGCTGCATCTCCCTCAAGCGCATGACCGACGTCTTCAAG
AAGTACGACGACGACCGCGACGGCTACATCACCCTCAGCTTCGAGGACTTTCTCAGCGAGATCCTCAAGCAGCTC
AAATAG
Transcript >Hirsu2|5141
ATGCTGTCGGAGAGGGAGCTGTCGGACGCGCTGGTCAACGGCGACTGGACGGCGTTCGACATCCAGACGGTGCGG
ATGATGATCCGCATGTTCGACTCGGACCGCAACGGCACCATCGGCTTCGACGAGTTCTGCGGGCTGTGGTCCTTC
CTGGCCTCGTGGCGCACCCTGTTCGACCGGTTCGACGTCGACCGGTCCGGCAACATCTCGCTCGCCGAGTTCACC
GACGCTCTCATCGCCTTCCGCTACCGCCTCAGCCCGGCCTTTGTCGAGCTGCTGTTCCGCACCTACGACAAGCGC
AACGAGGGCGTCATGAGCTTCGACCTCTTCGTCCAGAGCTGCATCTCCCTCAAGCGCATGACCGACGTCTTCAAG
AAGTACGACGACGACCGCGACGGCTACATCACCCTCAGCTTCGAGGACTTTCTCAGCGAGATCCTCAAGCAGCTC
AAATAG
Gene >Hirsu2|5141
ATGGTATGTCTTCTCTATCCGCCTTGCCTCTGCCCGCTATTTTGTGTCTTTTTTTGGTCCCGAGGGGGAGCTCAA
GCGGGGGGGGGGGGAGGAGAAAGAAGGAAAAAAAAAAAGCCGAGGCTGACAAGGCGCTCTTGGGGGTGGCGGCGC
GTGGCGGAAAACAGGCACCGGCCAGCTGTCGGAGAGGGAGCTGTCGGACGCGCTGGTCAACGGCGACTGGACGGC
GTTCGACATCCAGACGGTGCGGATGATGATCCGCATGTTCGACTCGGACCGCAACGGCACCATCGGCTTCGACGA
GTTCTGCGGGCTGTGGTCCTTCCTGGCCTCGTGGCGCACCCTGTTCGACCGGTTCGACGTCGACCGGTCCGGCAA
CATCTCGCTCGCCGAGTTCACCGACGCTCTCATCGCCTTCCGCTACCGCCTCAGCCCGGCCTTTGTCGAGCTGCT
GTTCCGCACCTACGACAAGCGCAACGAGGGCGTCATGAGCTTCGACCTCTTCGTCCAGAGCTGCATCTCCCTCAA
GCGCATGACCGACGTCTTCAAGAAGTACGACGACGACCGCGACGGCTACATCACCCTCAGCTTCGAGGACTTTCT
CAGCGAGATCCTCAAGCAGCTCAAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail