Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5130
Gene name
LocationContig_257:8910..10646
Strand-
Gene length (bp)1736
Transcript length (bp)1680
Coding sequence length (bp)1680
Protein length (aa) 560

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00022 Actin Actin 2.6E-17 59 402

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9QZB7|ARP10_MOUSE Actin-related protein 10 OS=Mus musculus GN=Actr10 PE=1 SV=2 59 410 7.0E-12
sp|Q3ZBD2|ARP10_BOVIN Actin-related protein 10 OS=Bos taurus GN=ACTR10 PE=2 SV=1 59 405 2.0E-11
sp|Q9NZ32|ARP10_HUMAN Actin-related protein 10 OS=Homo sapiens GN=ACTR10 PE=1 SV=1 59 405 6.0E-11
sp|Q554S6|ACT17_DICDI Actin-17 OS=Dictyostelium discoideum GN=act17 PE=3 SV=1 59 399 1.0E-07
sp|P20359|ACTG_EMENI Actin, gamma OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acnA PE=3 SV=2 59 399 8.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9QZB7|ARP10_MOUSE Actin-related protein 10 OS=Mus musculus GN=Actr10 PE=1 SV=2 59 410 7.0E-12
sp|Q3ZBD2|ARP10_BOVIN Actin-related protein 10 OS=Bos taurus GN=ACTR10 PE=2 SV=1 59 405 2.0E-11
sp|Q9NZ32|ARP10_HUMAN Actin-related protein 10 OS=Homo sapiens GN=ACTR10 PE=1 SV=1 59 405 6.0E-11
sp|Q554S6|ACT17_DICDI Actin-17 OS=Dictyostelium discoideum GN=act17 PE=3 SV=1 59 399 1.0E-07
sp|P20359|ACTG_EMENI Actin, gamma OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acnA PE=3 SV=2 59 399 8.0E-07
sp|Q9URS0|ACTG_PENCH Actin, gamma OS=Penicillium chrysogenum GN=ACT PE=3 SV=1 59 399 9.0E-07
sp|P78711|ACT_NEUCR Actin OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=act PE=3 SV=2 59 399 9.0E-07
sp|Q6TCF2|ACT_GAEGA Actin OS=Gaeumannomyces graminis var. avenae GN=ACT PE=2 SV=1 59 399 9.0E-07
sp|Q9UVW9|ACTG_ACRCH Actin, gamma OS=Acremonium chrysogenum GN=ACT PE=3 SV=1 59 399 9.0E-07
sp|O13419|ACT_BOTFU Actin OS=Botryotinia fuckeliana GN=actA PE=3 SV=1 59 399 1.0E-06
sp|O42161|ACTB_SALSA Actin, cytoplasmic 1 OS=Salmo salar GN=actb PE=2 SV=1 59 399 1.0E-06
sp|P10365|ACT_THELA Actin OS=Thermomyces lanuginosus PE=3 SV=1 59 399 1.0E-06
sp|O18499|ACT1_SACKO Actin-1 OS=Saccoglossus kowalevskii PE=2 SV=1 59 399 2.0E-06
sp|P48465|ACT_CRYNH Actin OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CNAG_00483 PE=3 SV=2 59 399 2.0E-06
sp|P30162|ACT1_ONCVO Actin-1 OS=Onchocerca volvulus GN=act-1a PE=3 SV=1 59 399 3.0E-06
sp|P90689|ACT_BRUMA Actin OS=Brugia malayi PE=1 SV=1 59 399 4.0E-06
sp|P10984|ACT2_CAEEL Actin-2 OS=Caenorhabditis elegans GN=act-2 PE=3 SV=3 55 399 4.0E-06
sp|P46258|ACT3_PEA Actin-3 OS=Pisum sativum PE=2 SV=1 64 399 4.0E-06
sp|P60010|ACT_YEAST Actin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACT1 PE=1 SV=1 59 399 5.0E-06
sp|P60011|ACT_SACBA Actin OS=Saccharomyces bayanus GN=ACT1 PE=3 SV=1 59 399 5.0E-06
sp|P60009|ACT_CANGA Actin OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ACT1 PE=3 SV=1 59 399 5.0E-06
sp|P53469|ACT2_OXYTR Actin, cytoplasmic OS=Oxytricha trifallax PE=3 SV=1 54 446 5.0E-06
sp|P15475|ACTB_XENBO Actin, cytoplasmic 1 OS=Xenopus borealis GN=actb PE=3 SV=1 54 399 5.0E-06
sp|P29751|ACTB_RABIT Actin, cytoplasmic 1 OS=Oryctolagus cuniculus GN=ACTB PE=2 SV=1 55 399 5.0E-06
sp|P53473|ACTB_STRPU Actin, cytoskeletal 1B OS=Strongylocentrotus purpuratus GN=CYIB PE=3 SV=1 54 399 6.0E-06
sp|P53496|ACT11_ARATH Actin-11 OS=Arabidopsis thaliana GN=ACT11 PE=1 SV=1 64 399 6.0E-06
sp|P53472|ACTA_STRPU Actin, cytoskeletal 1A OS=Strongylocentrotus purpuratus GN=CYIA PE=3 SV=1 55 399 7.0E-06
sp|O18500|ACT2_SACKO Actin-2 OS=Saccoglossus kowalevskii PE=2 SV=1 59 399 7.0E-06
sp|Q6NVA9|ACTB_XENTR Actin, cytoplasmic 1 OS=Xenopus tropicalis GN=actb PE=2 SV=1 55 399 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5130
MSSGAGQAPAHRSVASIRSAAPAQSQPGSSTPNTPPRSPRTISGSYSSASAIRADDDYILIEIGSRYVRAGFVGD
SLPKASLGWGPDQQRRAGDFRAWERPEPSATDVWAAEHELWRYDLRHVDLGLFRDKLDRLLRDAFTRYLLVDSRP
RRMGLVLDPAVPIPLLSAVLDMLFNSFQTPVVSLMSSPTMSAFAAGVRCALVVDMGWAETVVTSVYEYREVKTTR
TIRGGRFLLDALYDLLRGILVGGQAEEKGERVLSFDECEDILCRLMWCRASAFKSSQRQSAQLDTVEEQDESGAE
TSQPGGMAEIPLRTSSRHSTIKVPFGKLADVCDDTFFDLSASPATFDDHELPIHLLAYYHLLQLPMDVRAVCMSR
IMFTGGCSEILGVKERVVDEVTSIVDKRGWAPISGKGVEQVRNNAKLRKGSIQRSSVSSLATSESSGEDQDAARS
ESAATEASEDLVEAKIARNRPVTQQVQGQLRVIHSLGPWAGASLMCQLRLPAMATIEREQWLQHGAGGACRPSEV
DTKVHQRQSMGTGGIIRSSGAHHVNWTFGIWGAS*
Coding >Hirsu2|5130
ATGTCCTCTGGTGCGGGCCAGGCGCCCGCCCACCGGAGCGTGGCCAGCATTCGATCGGCAGCGCCGGCGCAAAGC
CAGCCGGGATCCTCGACACCCAATACTCCTCCGCGCAGCCCTCGCACCATATCGGGCTCATACAGCTCGGCGTCG
GCGATCCGAGCCGACGACGACTACATTCTGATTGAGATCGGATCGCGCTACGTTCGAGCGGGCTTCGTAGGCGAC
TCTCTCCCCAAGGCCTCACTCGGATGGGGACCGGACCAGCAACGCCGCGCGGGAGACTTCAGGGCGTGGGAGCGA
CCTGAACCGTCGGCGACGGATGTGTGGGCTGCTGAACACGAGCTGTGGCGATACGATTTACGGCACGTCGACCTA
GGACTTTTCCGCGACAAGCTCGATCGGCTTCTGCGGGATGCGTTTACGAGATACCTTCTCGTCGACTCGCGCCCT
CGGAGGATGGGGCTCGTCCTCGACCCTGCGGTTCCAATACCCCTGCTCTCGGCTGTCTTGGACATGCTGTTCAAC
AGCTTCCAGACGCCCGTGGTGTCGCTCATGTCCTCTCCCACCATGTCGGCCTTCGCGGCGGGTGTACGCTGTGCG
CTCGTGGTCGACATGGGATGGGCCGAGACGGTGGTCACGAGTGTGTACGAGTATCGAGAGGTCAAGACGACACGC
ACAATCCGAGGGGGCAGATTCCTCCTCGACGCCCTCTACGATCTCCTGCGCGGCATCCTGGTGGGCGGGCAGGCT
GAGGAGAAAGGGGAACGCGTCCTGAGCTTTGACGAGTGCGAAGACATCCTGTGCCGACTCATGTGGTGCCGAGCC
TCGGCTTTCAAGTCGTCGCAGCGTCAGTCTGCGCAGCTGGATACGGTGGAAGAGCAAGACGAGTCCGGCGCCGAG
ACAAGTCAGCCCGGCGGCATGGCCGAGATTCCCCTCAGAACGTCGAGCCGTCATTCGACGATCAAAGTCCCCTTT
GGGAAGTTGGCAGATGTCTGCGACGACACCTTCTTCGACCTGTCGGCATCGCCAGCCACCTTCGACGATCACGAG
CTCCCAATCCACCTGCTCGCCTACTACCATCTCCTGCAGCTACCGATGGACGTCAGGGCGGTCTGCATGTCTCGC
ATCATGTTCACGGGAGGCTGTTCGGAGATACTGGGCGTCAAAGAACGGGTCGTGGATGAAGTGACGAGCATCGTC
GACAAGAGGGGATGGGCGCCGATCTCGGGCAAGGGCGTCGAGCAGGTTCGCAACAACGCCAAGCTACGGAAGGGG
AGCATCCAGAGGTCGAGCGTCTCATCGCTGGCGACGTCCGAGTCGAGCGGGGAAGACCAGGACGCGGCGCGGTCC
GAATCAGCGGCGACCGAGGCATCCGAGGACCTGGTCGAGGCCAAGATTGCGCGCAATCGGCCGGTGACGCAGCAG
GTGCAAGGGCAACTGCGCGTCATTCACTCGCTGGGGCCGTGGGCTGGAGCGAGCCTGATGTGCCAGCTCAGGCTC
CCGGCCATGGCGACGATTGAGCGGGAGCAGTGGCTGCAACACGGCGCAGGCGGAGCCTGTCGGCCGAGTGAGGTC
GACACCAAGGTCCATCAGCGGCAGAGTATGGGCACGGGAGGCATCATCAGGAGCAGCGGAGCGCACCATGTGAAC
TGGACGTTTGGGATCTGGGGCGCGTCATGA
Transcript >Hirsu2|5130
ATGTCCTCTGGTGCGGGCCAGGCGCCCGCCCACCGGAGCGTGGCCAGCATTCGATCGGCAGCGCCGGCGCAAAGC
CAGCCGGGATCCTCGACACCCAATACTCCTCCGCGCAGCCCTCGCACCATATCGGGCTCATACAGCTCGGCGTCG
GCGATCCGAGCCGACGACGACTACATTCTGATTGAGATCGGATCGCGCTACGTTCGAGCGGGCTTCGTAGGCGAC
TCTCTCCCCAAGGCCTCACTCGGATGGGGACCGGACCAGCAACGCCGCGCGGGAGACTTCAGGGCGTGGGAGCGA
CCTGAACCGTCGGCGACGGATGTGTGGGCTGCTGAACACGAGCTGTGGCGATACGATTTACGGCACGTCGACCTA
GGACTTTTCCGCGACAAGCTCGATCGGCTTCTGCGGGATGCGTTTACGAGATACCTTCTCGTCGACTCGCGCCCT
CGGAGGATGGGGCTCGTCCTCGACCCTGCGGTTCCAATACCCCTGCTCTCGGCTGTCTTGGACATGCTGTTCAAC
AGCTTCCAGACGCCCGTGGTGTCGCTCATGTCCTCTCCCACCATGTCGGCCTTCGCGGCGGGTGTACGCTGTGCG
CTCGTGGTCGACATGGGATGGGCCGAGACGGTGGTCACGAGTGTGTACGAGTATCGAGAGGTCAAGACGACACGC
ACAATCCGAGGGGGCAGATTCCTCCTCGACGCCCTCTACGATCTCCTGCGCGGCATCCTGGTGGGCGGGCAGGCT
GAGGAGAAAGGGGAACGCGTCCTGAGCTTTGACGAGTGCGAAGACATCCTGTGCCGACTCATGTGGTGCCGAGCC
TCGGCTTTCAAGTCGTCGCAGCGTCAGTCTGCGCAGCTGGATACGGTGGAAGAGCAAGACGAGTCCGGCGCCGAG
ACAAGTCAGCCCGGCGGCATGGCCGAGATTCCCCTCAGAACGTCGAGCCGTCATTCGACGATCAAAGTCCCCTTT
GGGAAGTTGGCAGATGTCTGCGACGACACCTTCTTCGACCTGTCGGCATCGCCAGCCACCTTCGACGATCACGAG
CTCCCAATCCACCTGCTCGCCTACTACCATCTCCTGCAGCTACCGATGGACGTCAGGGCGGTCTGCATGTCTCGC
ATCATGTTCACGGGAGGCTGTTCGGAGATACTGGGCGTCAAAGAACGGGTCGTGGATGAAGTGACGAGCATCGTC
GACAAGAGGGGATGGGCGCCGATCTCGGGCAAGGGCGTCGAGCAGGTTCGCAACAACGCCAAGCTACGGAAGGGG
AGCATCCAGAGGTCGAGCGTCTCATCGCTGGCGACGTCCGAGTCGAGCGGGGAAGACCAGGACGCGGCGCGGTCC
GAATCAGCGGCGACCGAGGCATCCGAGGACCTGGTCGAGGCCAAGATTGCGCGCAATCGGCCGGTGACGCAGCAG
GTGCAAGGGCAACTGCGCGTCATTCACTCGCTGGGGCCGTGGGCTGGAGCGAGCCTGATGTGCCAGCTCAGGCTC
CCGGCCATGGCGACGATTGAGCGGGAGCAGTGGCTGCAACACGGCGCAGGCGGAGCCTGTCGGCCGAGTGAGGTC
GACACCAAGGTCCATCAGCGGCAGAGTATGGGCACGGGAGGCATCATCAGGAGCAGCGGAGCGCACCATGTGAAC
TGGACGTTTGGGATCTGGGGCGCGTCATGA
Gene >Hirsu2|5130
ATGTCCTCTGGTGCGGGCCAGGCGCCCGCCCACCGGAGCGTGGCCAGCATTCGATCGGCAGCGCCGGCGCAAAGC
CAGCCGGGATCCTCGACACCCAATACTCCTCCGCGCAGCCCTCGCACCATATCGGGCTCATACAGCTCGGCGTCG
GCGATCCGAGCCGACGACGACTACATTCTGATTGAGATCGGATCGCGCTACGTTCGAGCGGGCTTCGTAGGCGAC
TCTCTCCCCAAGGCCTCACTCGGATGGGGACCGGACCAGCAACGCCGCGCGGGAGACTTCAGGGCGTGGGAGCGA
CCTGAACCGTCGGCGACGGATGTGTGGGCTGCTGAACACGAGCTGTGGCGATACGATTTACGGCACGTCGACCTA
GGACTTTTCCGCGACAAGCTCGATCGGCTTCTGCGGGATGCGTTTACGAGGTACGGACGTCGCCAGAGCCCACAT
AGCGCAGCGGCCTACTGACCAGACTGCGCAGATACCTTCTCGTCGACTCGCGCCCTCGGAGGATGGGGCTCGTCC
TCGACCCTGCGGTTCCAATACCCCTGCTCTCGGCTGTCTTGGACATGCTGTTCAACAGCTTCCAGACGCCCGTGG
TGTCGCTCATGTCCTCTCCCACCATGTCGGCCTTCGCGGCGGGTGTACGCTGTGCGCTCGTGGTCGACATGGGAT
GGGCCGAGACGGTGGTCACGAGTGTGTACGAGTATCGAGAGGTCAAGACGACACGCACAATCCGAGGGGGCAGAT
TCCTCCTCGACGCCCTCTACGATCTCCTGCGCGGCATCCTGGTGGGCGGGCAGGCTGAGGAGAAAGGGGAACGCG
TCCTGAGCTTTGACGAGTGCGAAGACATCCTGTGCCGACTCATGTGGTGCCGAGCCTCGGCTTTCAAGTCGTCGC
AGCGTCAGTCTGCGCAGCTGGATACGGTGGAAGAGCAAGACGAGTCCGGCGCCGAGACAAGTCAGCCCGGCGGCA
TGGCCGAGATTCCCCTCAGAACGTCGAGCCGTCATTCGACGATCAAAGTCCCCTTTGGGAAGTTGGCAGATGTCT
GCGACGACACCTTCTTCGACCTGTCGGCATCGCCAGCCACCTTCGACGATCACGAGCTCCCAATCCACCTGCTCG
CCTACTACCATCTCCTGCAGCTACCGATGGACGTCAGGGCGGTCTGCATGTCTCGCATCATGTTCACGGGAGGCT
GTTCGGAGATACTGGGCGTCAAAGAACGGGTCGTGGATGAAGTGACGAGCATCGTCGACAAGAGGGGATGGGCGC
CGATCTCGGGCAAGGGCGTCGAGCAGGTTCGCAACAACGCCAAGCTACGGAAGGGGAGCATCCAGAGGTCGAGCG
TCTCATCGCTGGCGACGTCCGAGTCGAGCGGGGAAGACCAGGACGCGGCGCGGTCCGAATCAGCGGCGACCGAGG
CATCCGAGGACCTGGTCGAGGCCAAGATTGCGCGCAATCGGCCGGTGACGCAGCAGGTGCAAGGGCAACTGCGCG
TCATTCACTCGCTGGGGCCGTGGGCTGGAGCGAGCCTGATGTGCCAGCTCAGGCTCCCGGCCATGGCGACGATTG
AGCGGGAGCAGTGGCTGCAACACGGCGCAGGCGGAGCCTGTCGGCCGAGTGAGGTCGACACCAAGGTCCATCAGC
GGCAGAGTATGGGCACGGGAGGCATCATCAGGAGCAGCGGAGCGCACCATGTGAACTGGACGTTTGGGATCTGGG
GCGCGTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail