Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5128
Gene name
LocationContig_257:3520..5667
Strand+
Gene length (bp)2147
Transcript length (bp)1908
Coding sequence length (bp)1908
Protein length (aa) 636

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 3.3E-75 245 534
PF07714 Pkinase_Tyr Protein tyrosine kinase 3.3E-22 247 394
PF07714 Pkinase_Tyr Protein tyrosine kinase 3.9E-06 436 493

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O42626|NRC2_NEUCR Serine/threonine-protein kinase nrc-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nrc-2 PE=3 SV=1 7 612 0.0E+00
sp|Q09831|PPK14_SCHPO Serine/threonine-protein kinase ppk14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk14 PE=1 SV=1 225 611 0.0E+00
sp|Q9USX7|PPK22_SCHPO Serine/threonine-protein kinase ppk22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk22 PE=1 SV=1 224 612 2.0E-179
sp|P53739|FPK1_YEAST Flippase kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FPK1 PE=1 SV=1 211 606 9.0E-161
sp|P25341|KIN82_YEAST Serine/threonine-protein kinase KIN82 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN82 PE=1 SV=3 233 606 5.0E-151
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O42626|NRC2_NEUCR Serine/threonine-protein kinase nrc-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nrc-2 PE=3 SV=1 7 612 0.0E+00
sp|Q09831|PPK14_SCHPO Serine/threonine-protein kinase ppk14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk14 PE=1 SV=1 225 611 0.0E+00
sp|Q9USX7|PPK22_SCHPO Serine/threonine-protein kinase ppk22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk22 PE=1 SV=1 224 612 2.0E-179
sp|P53739|FPK1_YEAST Flippase kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FPK1 PE=1 SV=1 211 606 9.0E-161
sp|P25341|KIN82_YEAST Serine/threonine-protein kinase KIN82 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN82 PE=1 SV=3 233 606 5.0E-151
sp|P93025|PHOT2_ARATH Phototropin-2 OS=Arabidopsis thaliana GN=PHOT2 PE=1 SV=2 239 553 9.0E-98
sp|F4I4F2|RHS3_ARATH Serine/threonine-protein kinase RHS3 OS=Arabidopsis thaliana GN=RHS3 PE=1 SV=1 225 553 1.0E-96
sp|Q2RBR1|PHT1B_ORYSJ Phototropin-1B OS=Oryza sativa subsp. japonica GN=PHOT1B PE=1 SV=2 239 553 2.0E-94
sp|Q2QYY8|PHT1A_ORYSJ Phototropin-1A OS=Oryza sativa subsp. japonica GN=PHOT1A PE=1 SV=2 239 553 2.0E-94
sp|Q1PFB9|AGC17_ARATH Serine/threonine-protein kinase AGC1-7 OS=Arabidopsis thaliana GN=AGC1-7 PE=1 SV=1 225 553 6.0E-94
sp|Q9ST27|PHOT2_ORYSJ Phototropin-2 OS=Oryza sativa subsp. japonica GN=PHOT2 PE=1 SV=1 238 557 7.0E-93
sp|Q9LTW5|AGC15_ARATH Serine/threonine-protein kinase AGC1-5 OS=Arabidopsis thaliana GN=AGC1-5 PE=1 SV=1 230 553 2.0E-92
sp|A2YBX5|G11A_ORYSI Protein kinase G11A OS=Oryza sativa subsp. indica GN=OsI_021818 PE=2 SV=1 174 553 9.0E-90
sp|Q0DCT8|G11A_ORYSJ Protein kinase G11A OS=Oryza sativa subsp. japonica GN=Os06g0291600 PE=2 SV=1 174 553 1.0E-89
sp|Q9LFA2|KIPK_ARATH Serine/threonine-protein kinase KIPK OS=Arabidopsis thaliana GN=KIPK PE=1 SV=1 232 551 7.0E-89
sp|O48963|PHOT1_ARATH Phototropin-1 OS=Arabidopsis thaliana GN=PHOT1 PE=1 SV=1 239 553 4.0E-88
sp|Q05999|D6KL3_ARATH Serine/threonine-protein kinase D6PKL3 OS=Arabidopsis thaliana GN=D6PKL3 PE=1 SV=1 244 558 4.0E-86
sp|P15792|KPK1_PHAVU Protein kinase PVPK-1 OS=Phaseolus vulgaris PE=2 SV=1 225 578 1.0E-85
sp|Q39183|D6KL2_ARATH Serine/threonine-protein kinase D6PKL2 OS=Arabidopsis thaliana GN=D6PKL2 PE=1 SV=1 225 553 5.0E-85
sp|Q2QM77|PID_ORYSJ Protein kinase PINOID OS=Oryza sativa subsp. japonica GN=PID PE=2 SV=1 239 556 3.0E-84
sp|Q9SUA3|D6KL1_ARATH Serine/threonine-protein kinase D6PKL1 OS=Arabidopsis thaliana GN=D6PKL1 PE=1 SV=1 225 553 1.0E-83
sp|Q9FG74|D6PK_ARATH Serine/threonine-protein kinase D6PK OS=Arabidopsis thaliana GN=D6PK PE=1 SV=1 225 553 5.0E-83
sp|O64682|PID_ARATH Protein kinase PINOID OS=Arabidopsis thaliana GN=PID PE=1 SV=1 244 551 1.0E-78
sp|P34102|PK3_DICDI Protein kinase 3 OS=Dictyostelium discoideum GN=pkgC PE=3 SV=2 244 551 3.0E-75
sp|Q9P7J8|GAD8_SCHPO Serine/threonine-protein kinase gad8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gad8 PE=1 SV=1 243 588 3.0E-73
sp|Q9LUL2|WAG2_ARATH Serine/threonine-protein kinase WAG2 OS=Arabidopsis thaliana GN=WAG2 PE=2 SV=1 247 548 2.0E-71
sp|P54644|KRAC_DICDI RAC family serine/threonine-protein kinase homolog OS=Dictyostelium discoideum GN=pkbA PE=1 SV=1 238 559 3.0E-71
sp|Q2PJ68|SGK1_CAEEL Serine/threonine-protein kinase sgk-1 OS=Caenorhabditis elegans GN=sgk-1 PE=1 SV=1 236 578 5.0E-71
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 241 562 2.0E-70
sp|Q9NAH6|KS6B_CAEEL Ribosomal protein S6 kinase beta OS=Caenorhabditis elegans GN=rsks-1 PE=1 SV=2 208 604 3.0E-70
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 229 562 3.0E-70
sp|Q9LT38|UNCL_ARATH Serine/threonine-protein kinase UCNL OS=Arabidopsis thaliana GN=UCNL PE=2 SV=1 243 601 1.0E-69
sp|Q7ZTW4|SGK1_DANRE Serine/threonine-protein kinase Sgk1 OS=Danio rerio GN=sgk1 PE=2 SV=1 241 552 1.0E-68
sp|Q8INB9|AKT1_DROME RAC serine/threonine-protein kinase OS=Drosophila melanogaster GN=Akt1 PE=1 SV=3 228 574 1.0E-68
sp|Q5Q0U5|SGK1_FUNHE Serine/threonine-protein kinase Sgk1 OS=Fundulus heteroclitus GN=sgk1 PE=2 SV=1 236 602 2.0E-68
sp|Q5R7A7|SGK3_PONAB Serine/threonine-protein kinase Sgk3 OS=Pongo abelii GN=SGK3 PE=2 SV=1 235 602 3.0E-68
sp|Q96BR1|SGK3_HUMAN Serine/threonine-protein kinase Sgk3 OS=Homo sapiens GN=SGK3 PE=1 SV=1 235 602 3.0E-68
sp|Q6PFQ0|KS6A6_DANRE Ribosomal protein S6 kinase alpha-6 OS=Danio rerio GN=rps6ka6 PE=2 SV=1 241 562 4.0E-68
sp|Q6U1I9|SGK1_CHICK Serine/threonine-protein kinase Sgk1 OS=Gallus gallus GN=SGK1 PE=2 SV=1 241 552 4.0E-68
sp|Q6TGC6|CBK1_PNECA Serine/threonine-protein kinase CBK1 OS=Pneumocystis carinii GN=CBK1 PE=2 SV=1 229 565 4.0E-68
sp|A8XNJ6|SGK1_CAEBR Serine/threonine-protein kinase sgk-1 OS=Caenorhabditis briggsae GN=sgk-1 PE=3 SV=3 237 561 5.0E-68
sp|Q8MYF1|Y2070_DICDI Probable serine/threonine-protein kinase DDB_G0277449 OS=Dictyostelium discoideum GN=DDB_G0277449 PE=3 SV=1 232 562 6.0E-68
sp|Q6GLY8|SGK1B_XENLA Serine/threonine-protein kinase Sgk1-B OS=Xenopus laevis GN=sgk1-b PE=2 SV=1 194 552 9.0E-68
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 216 562 1.0E-67
sp|Q9WVC6|SGK1_MOUSE Serine/threonine-protein kinase Sgk1 OS=Mus musculus GN=Sgk1 PE=1 SV=1 241 551 1.0E-67
sp|Q8R4V0|SGK3_RAT Serine/threonine-protein kinase Sgk3 OS=Rattus norvegicus GN=Sgk3 PE=1 SV=2 235 602 2.0E-67
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 241 562 2.0E-67
sp|Q5BKK4|SGK1_XENTR Serine/threonine-protein kinase Sgk1 OS=Xenopus tropicalis GN=sgk1 PE=2 SV=1 236 552 2.0E-67
sp|Q9C8M5|WAG1_ARATH Serine/threonine-protein kinase WAG1 OS=Arabidopsis thaliana GN=WAG1 PE=2 SV=1 244 548 2.0E-67
sp|Q6GPN6|SGK1A_XENLA Serine/threonine-protein kinase Sgk1-A OS=Xenopus laevis GN=sgk1-a PE=2 SV=1 241 552 2.0E-67
sp|Q9ERE3|SGK3_MOUSE Serine/threonine-protein kinase Sgk3 OS=Mus musculus GN=Sgk3 PE=1 SV=1 235 602 2.0E-67
sp|P50530|SCK1_SCHPO Serine/threonine-protein kinase sck1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sck1 PE=1 SV=2 234 562 4.0E-67
sp|F4HYG2|IRE3_ARATH Probable serine/threonine protein kinase IRE3 OS=Arabidopsis thaliana GN=IRE3 PE=2 SV=1 225 564 6.0E-67
sp|Q9XT18|SGK1_RABIT Serine/threonine-protein kinase Sgk1 OS=Oryctolagus cuniculus GN=SGK1 PE=2 SV=1 241 552 7.0E-67
sp|Q9LE81|IRE_ARATH Probable serine/threonine protein kinase IRE OS=Arabidopsis thaliana GN=IRE PE=2 SV=1 244 551 8.0E-67
sp|A7MB74|SGK1_BOVIN Serine/threonine-protein kinase Sgk1 OS=Bos taurus GN=SGK1 PE=2 SV=1 241 552 1.0E-66
sp|O00141|SGK1_HUMAN Serine/threonine-protein kinase Sgk1 OS=Homo sapiens GN=SGK1 PE=1 SV=2 241 552 1.0E-66
sp|F4HPN2|IRE4_ARATH Probable serine/threonine protein kinase IRE4 OS=Arabidopsis thaliana GN=IRE4 PE=2 SV=1 244 607 1.0E-66
sp|P51817|PRKX_HUMAN cAMP-dependent protein kinase catalytic subunit PRKX OS=Homo sapiens GN=PRKX PE=1 SV=1 244 569 1.0E-66
sp|Q06226|SGK1_RAT Serine/threonine-protein kinase Sgk1 OS=Rattus norvegicus GN=Sgk1 PE=1 SV=1 241 552 2.0E-66
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 241 562 2.0E-66
sp|Q8BSK8|KS6B1_MOUSE Ribosomal protein S6 kinase beta-1 OS=Mus musculus GN=Rps6kb1 PE=1 SV=2 228 551 2.0E-66
sp|Q4R633|SGK1_MACFA Serine/threonine-protein kinase Sgk1 OS=Macaca fascicularis GN=SGK1 PE=2 SV=1 241 552 2.0E-66
sp|P67999|KS6B1_RAT Ribosomal protein S6 kinase beta-1 OS=Rattus norvegicus GN=Rps6kb1 PE=1 SV=1 228 551 2.0E-66
sp|P67998|KS6B1_RABIT Ribosomal protein S6 kinase beta-1 OS=Oryctolagus cuniculus GN=RPS6KB1 PE=2 SV=1 228 551 2.0E-66
sp|Q9UK32|KS6A6_HUMAN Ribosomal protein S6 kinase alpha-6 OS=Homo sapiens GN=RPS6KA6 PE=1 SV=1 241 562 2.0E-66
sp|Q6TJY3|KS6B1_BOVIN Ribosomal protein S6 kinase beta-1 OS=Bos taurus GN=RPS6KB1 PE=2 SV=1 228 551 2.0E-66
sp|P23443|KS6B1_HUMAN Ribosomal protein S6 kinase beta-1 OS=Homo sapiens GN=RPS6KB1 PE=1 SV=2 228 551 2.0E-66
sp|Q7TPS0|KS6A6_MOUSE Ribosomal protein S6 kinase alpha-6 OS=Mus musculus GN=Rps6ka6 PE=1 SV=2 241 562 3.0E-66
sp|Q9SYB9|UNC_ARATH Serine/threonine-protein kinase UCN OS=Arabidopsis thaliana GN=UNC PE=1 SV=1 247 551 6.0E-66
sp|Q39030|KPK2_ARATH Serine/threonine-protein kinase AtPK2/AtPK19 OS=Arabidopsis thaliana GN=ATPK2 PE=1 SV=2 239 604 6.0E-66
sp|F4J6F6|IREH1_ARATH Probable serine/threonine protein kinase IREH1 OS=Arabidopsis thaliana GN=IREH1 PE=1 SV=1 244 564 1.0E-65
sp|Q6CFS5|CBK1_YARLI Serine/threonine-protein kinase CBK1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CBK1 PE=3 SV=1 232 562 1.0E-65
sp|P05132|KAPCA_MOUSE cAMP-dependent protein kinase catalytic subunit alpha OS=Mus musculus GN=Prkaca PE=1 SV=3 243 569 2.0E-65
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 212 562 2.0E-65
sp|Q9Y243|AKT3_HUMAN RAC-gamma serine/threonine-protein kinase OS=Homo sapiens GN=AKT3 PE=1 SV=1 242 574 2.0E-65
sp|Q9WUA6|AKT3_MOUSE RAC-gamma serine/threonine-protein kinase OS=Mus musculus GN=Akt3 PE=1 SV=1 242 574 3.0E-65
sp|P11792|SCH9_YEAST Serine/threonine-protein kinase SCH9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCH9 PE=1 SV=3 240 562 3.0E-65
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 212 562 4.0E-65
sp|P27791|KAPCA_RAT cAMP-dependent protein kinase catalytic subunit alpha OS=Rattus norvegicus GN=Prkaca PE=1 SV=2 244 569 5.0E-65
sp|P42818|KPK1_ARATH Serine/threonine-protein kinase AtPK1/AtPK6 OS=Arabidopsis thaliana GN=ATPK1 PE=1 SV=1 232 551 6.0E-65
sp|P18961|YPK2_YEAST Serine/threonine-protein kinase YPK2/YKR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK2 PE=1 SV=1 221 562 8.0E-65
sp|Q7ZX15|AKT2A_XENLA RAC-beta serine/threonine-protein kinase A OS=Xenopus laevis GN=akt2-a PE=2 SV=1 238 574 8.0E-65
sp|Q5AP53|CBK1_CANAL Serine/threonine-protein kinase CBK1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CBK1 PE=1 SV=1 229 562 1.0E-64
sp|Q13464|ROCK1_HUMAN Rho-associated protein kinase 1 OS=Homo sapiens GN=ROCK1 PE=1 SV=1 223 567 1.0E-64
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 242 562 1.0E-64
sp|P25321|KAPCA_CRIGR cAMP-dependent protein kinase catalytic subunit alpha OS=Cricetulus griseus GN=PRKACA PE=1 SV=2 244 569 1.0E-64
sp|Q63484|AKT3_RAT RAC-gamma serine/threonine-protein kinase OS=Rattus norvegicus GN=Akt3 PE=2 SV=2 242 574 1.0E-64
sp|O77819|ROCK1_RABIT Rho-associated protein kinase 1 OS=Oryctolagus cuniculus GN=ROCK1 PE=1 SV=1 223 567 1.0E-64
sp|Q9UBS0|KS6B2_HUMAN Ribosomal protein S6 kinase beta-2 OS=Homo sapiens GN=RPS6KB2 PE=1 SV=2 228 551 1.0E-64
sp|P70335|ROCK1_MOUSE Rho-associated protein kinase 1 OS=Mus musculus GN=Rock1 PE=1 SV=1 223 567 1.0E-64
sp|Q63644|ROCK1_RAT Rho-associated protein kinase 1 OS=Rattus norvegicus GN=Rock1 PE=1 SV=1 223 567 1.0E-64
sp|P28178|PK2_DICDI Protein kinase 2 OS=Dictyostelium discoideum GN=pkgB PE=1 SV=2 244 549 2.0E-64
sp|P12688|YPK1_YEAST Serine/threonine-protein kinase YPK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK1 PE=1 SV=2 235 562 3.0E-64
sp|P17612|KAPCA_HUMAN cAMP-dependent protein kinase catalytic subunit alpha OS=Homo sapiens GN=PRKACA PE=1 SV=2 243 569 4.0E-64
sp|P47197|AKT2_RAT RAC-beta serine/threonine-protein kinase OS=Rattus norvegicus GN=Akt2 PE=1 SV=1 238 574 5.0E-64
sp|Q9HBY8|SGK2_HUMAN Serine/threonine-protein kinase Sgk2 OS=Homo sapiens GN=SGK2 PE=1 SV=1 236 552 6.0E-64
sp|P36887|KAPCA_PIG cAMP-dependent protein kinase catalytic subunit alpha OS=Sus scrofa GN=PRKACA PE=1 SV=4 243 569 6.0E-64
sp|P10666|KS6AB_XENLA Ribosomal protein S6 kinase 2 beta OS=Xenopus laevis PE=2 SV=1 242 562 6.0E-64
sp|Q6BLJ9|CBK1_DEBHA Serine/threonine-protein kinase CBK1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CBK1 PE=3 SV=2 229 601 7.0E-64
sp|Q6FP74|CBK1_CANGA Serine/threonine-protein kinase CBK1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CBK1 PE=3 SV=1 244 562 1.0E-63
sp|Q60823|AKT2_MOUSE RAC-beta serine/threonine-protein kinase OS=Mus musculus GN=Akt2 PE=1 SV=1 238 574 1.0E-63
sp|Q922R0|PRKX_MOUSE cAMP-dependent protein kinase catalytic subunit PRKX OS=Mus musculus GN=Prkx PE=1 SV=1 244 569 1.0E-63
sp|P22694|KAPCB_HUMAN cAMP-dependent protein kinase catalytic subunit beta OS=Homo sapiens GN=PRKACB PE=1 SV=2 240 574 2.0E-63
sp|Q8MJ44|KAPCA_CANLF cAMP-dependent protein kinase catalytic subunit alpha OS=Canis lupus familiaris GN=PRKACA PE=1 SV=3 243 569 2.0E-63
sp|P05383|KAPCB_PIG cAMP-dependent protein kinase catalytic subunit beta OS=Sus scrofa GN=PRKACB PE=1 SV=3 240 574 2.0E-63
sp|P05131|KAPCB_BOVIN cAMP-dependent protein kinase catalytic subunit beta OS=Bos taurus GN=PRKACB PE=1 SV=2 240 574 3.0E-63
sp|P00517|KAPCA_BOVIN cAMP-dependent protein kinase catalytic subunit alpha OS=Bos taurus GN=PRKACA PE=1 SV=3 243 569 3.0E-63
sp|Q9MZD9|KAPCA_SHEEP cAMP-dependent protein kinase catalytic subunit alpha OS=Ovis aries GN=PRKACA PE=1 SV=3 243 569 3.0E-63
sp|P68182|KAPCB_RAT cAMP-dependent protein kinase catalytic subunit beta OS=Rattus norvegicus GN=Prkacb PE=1 SV=2 240 569 3.0E-63
sp|P68181|KAPCB_MOUSE cAMP-dependent protein kinase catalytic subunit beta OS=Mus musculus GN=Prkacb PE=1 SV=2 240 569 3.0E-63
sp|P68180|KAPCB_CRIGR cAMP-dependent protein kinase catalytic subunit beta OS=Cricetulus griseus GN=PRKACB PE=2 SV=2 240 569 3.0E-63
sp|P49673|KAPC_ASCSU cAMP-dependent protein kinase catalytic subunit OS=Ascaris suum GN=CAPK PE=2 SV=1 229 575 3.0E-63
sp|O75116|ROCK2_HUMAN Rho-associated protein kinase 2 OS=Homo sapiens GN=ROCK2 PE=1 SV=4 223 567 4.0E-63
sp|Q28021|ROCK2_BOVIN Rho-associated protein kinase 2 OS=Bos taurus GN=ROCK2 PE=1 SV=1 202 567 6.0E-63
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 215 551 6.0E-63
sp|P34099|KAPC_DICDI cAMP-dependent protein kinase catalytic subunit OS=Dictyostelium discoideum GN=pkaC PE=1 SV=2 244 572 6.0E-63
sp|P38679|COT1_NEUCR Serine/threonine-protein kinase cot-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cot-1 PE=2 SV=2 241 562 1.0E-62
sp|P31751|AKT2_HUMAN RAC-beta serine/threonine-protein kinase OS=Homo sapiens GN=AKT2 PE=1 SV=2 238 574 1.0E-62
sp|M3TYT0|ROCK2_PIG Rho-associated protein kinase 2 OS=Sus scrofa GN=ROCK2 PE=1 SV=1 223 567 1.0E-62
sp|P05986|KAPC_YEAST cAMP-dependent protein kinase type 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK3 PE=1 SV=2 242 601 1.0E-62
sp|Q6IP76|AKT2B_XENLA RAC-beta serine/threonine-protein kinase B OS=Xenopus laevis GN=akt2-b PE=2 SV=1 238 574 2.0E-62
sp|Q9Z1M4|KS6B2_MOUSE Ribosomal protein S6 kinase beta-2 OS=Mus musculus GN=Rps6kb2 PE=1 SV=1 228 551 2.0E-62
sp|P31034|CBK1_KLULA Serine/threonine-protein kinase CBK1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CBK1 PE=3 SV=2 244 562 5.0E-62
sp|Q9QZS5|SGK2_MOUSE Serine/threonine-protein kinase Sgk2 OS=Mus musculus GN=Sgk2 PE=1 SV=1 236 552 6.0E-62
sp|Q7JP68|KAPC2_CAEEL cAMP-dependent protein kinase, catalytic subunit-like OS=Caenorhabditis elegans GN=F47F2.1 PE=1 SV=1 242 567 6.0E-62
sp|P53894|CBK1_YEAST Serine/threonine-protein kinase CBK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CBK1 PE=1 SV=1 244 562 6.0E-62
sp|P70336|ROCK2_MOUSE Rho-associated protein kinase 2 OS=Mus musculus GN=Rock2 PE=1 SV=1 223 567 7.0E-62
sp|Q8R4U9|SGK2_RAT Serine/threonine-protein kinase Sgk2 OS=Rattus norvegicus GN=Sgk2 PE=1 SV=2 236 552 1.0E-61
sp|Q12706|PSK1_SCHPO Serine/threonine-protein kinase psk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psk1 PE=3 SV=1 241 551 1.0E-61
sp|P06244|KAPA_YEAST cAMP-dependent protein kinase type 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK1 PE=1 SV=3 176 601 1.0E-61
sp|Q2LZZ7|TRC_DROPS Serine/threonine-protein kinase tricorner OS=Drosophila pseudoobscura pseudoobscura GN=trc PE=3 SV=1 229 562 2.0E-61
sp|P16912|KDC2_DROME Protein kinase DC2 OS=Drosophila melanogaster GN=Pka-C3 PE=2 SV=2 244 569 2.0E-61
sp|O13310|ORB6_SCHPO Serine/threonine-protein kinase orb6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=orb6 PE=1 SV=1 229 571 2.0E-61
sp|Q754N7|CBK1_ASHGO Serine/threonine-protein kinase CBK1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CBK1 PE=3 SV=1 244 562 4.0E-61
sp|P31750|AKT1_MOUSE RAC-alpha serine/threonine-protein kinase OS=Mus musculus GN=Akt1 PE=1 SV=2 239 574 5.0E-61
sp|P47196|AKT1_RAT RAC-alpha serine/threonine-protein kinase OS=Rattus norvegicus GN=Akt1 PE=1 SV=1 239 574 5.0E-61
sp|P31748|AKT_MLVAT AKT kinase-transforming protein OS=AKT8 murine leukemia virus GN=V-AKT PE=1 SV=1 239 574 8.0E-61
sp|P31749|AKT1_HUMAN RAC-alpha serine/threonine-protein kinase OS=Homo sapiens GN=AKT1 PE=1 SV=2 239 574 9.0E-61
sp|Q811L6|MAST4_MOUSE Microtubule-associated serine/threonine-protein kinase 4 OS=Mus musculus GN=Mast4 PE=1 SV=3 173 562 1.0E-60
sp|Q01314|AKT1_BOVIN RAC-alpha serine/threonine-protein kinase OS=Bos taurus GN=AKT1 PE=1 SV=2 239 574 1.0E-60
sp|Q5AHG6|SCH9_CANAL Serine/threonine-protein kinase SCH9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SCH9 PE=3 SV=1 225 587 1.0E-60
sp|Q9NBK5|TRC_DROME Serine/threonine-protein kinase tricorner OS=Drosophila melanogaster GN=trc PE=1 SV=1 229 562 1.0E-60
sp|Q810W7|MAST1_RAT Microtubule-associated serine/threonine-protein kinase 1 OS=Rattus norvegicus GN=Mast1 PE=1 SV=1 240 562 2.0E-60
sp|Q9R1L5|MAST1_MOUSE Microtubule-associated serine/threonine-protein kinase 1 OS=Mus musculus GN=Mast1 PE=1 SV=3 240 562 2.0E-60
sp|P22612|KAPCG_HUMAN cAMP-dependent protein kinase catalytic subunit gamma OS=Homo sapiens GN=PRKACG PE=1 SV=3 243 569 3.0E-60
sp|Q9LSF1|OXI1_ARATH Serine/threonine-protein kinase OXI1 OS=Arabidopsis thaliana GN=OXI1 PE=1 SV=1 247 558 3.0E-60
sp|O75676|KS6A4_HUMAN Ribosomal protein S6 kinase alpha-4 OS=Homo sapiens GN=RPS6KA4 PE=1 SV=1 238 562 3.0E-60
sp|Q9Y2H9|MAST1_HUMAN Microtubule-associated serine/threonine-protein kinase 1 OS=Homo sapiens GN=MAST1 PE=1 SV=2 240 562 5.0E-60
sp|Q54Y26|NDRA_DICDI Probable serine/threonine-protein kinase ndrA OS=Dictyostelium discoideum GN=ndrA PE=3 SV=1 229 562 7.0E-60
sp|A8XJQ6|KAPC2_CAEBR cAMP-dependent protein kinase, catalytic subunit-like OS=Caenorhabditis briggsae GN=CBG14305 PE=1 SV=2 242 567 8.0E-60
sp|O15021|MAST4_HUMAN Microtubule-associated serine/threonine-protein kinase 4 OS=Homo sapiens GN=MAST4 PE=1 SV=3 173 562 9.0E-60
sp|Q62868|ROCK2_RAT Rho-associated protein kinase 2 OS=Rattus norvegicus GN=Rock2 PE=1 SV=2 223 567 9.0E-60
sp|Q17941|AKT1_CAEEL Serine/threonine-protein kinase akt-1 OS=Caenorhabditis elegans GN=akt-1 PE=1 SV=2 218 574 9.0E-60
sp|P12370|KAPC_DROME cAMP-dependent protein kinase catalytic subunit OS=Drosophila melanogaster GN=Pka-C1 PE=1 SV=3 244 576 1.0E-59
sp|P13678|KPC3_DROME Protein kinase C OS=Drosophila melanogaster GN=Pkc98E PE=2 SV=1 244 562 1.0E-59
sp|A8XW88|KAPC1_CAEBR cAMP-dependent protein kinase catalytic subunit OS=Caenorhabditis briggsae GN=kin-1 PE=1 SV=1 244 548 1.0E-59
sp|P21137|KAPC1_CAEEL cAMP-dependent protein kinase catalytic subunit OS=Caenorhabditis elegans GN=kin-1 PE=1 SV=3 244 548 1.0E-59
sp|Q9Z2B9|KS6A4_MOUSE Ribosomal protein S6 kinase alpha-4 OS=Mus musculus GN=Rps6ka4 PE=1 SV=2 238 562 3.0E-59
sp|Q98TY9|AKT1_XENLA RAC-alpha serine/threonine-protein kinase OS=Xenopus laevis GN=akt1 PE=2 SV=1 238 574 3.0E-59
sp|Q4V3C8|PDPK2_ARATH 3-phosphoinositide-dependent protein kinase 2 OS=Arabidopsis thaliana GN=PDPK2 PE=1 SV=1 244 554 5.0E-59
sp|P06245|KAPB_YEAST cAMP-dependent protein kinase type 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK2 PE=1 SV=2 244 569 8.0E-59
sp|Q54IH8|NDRB_DICDI Probable serine/threonine-protein kinase ndrB OS=Dictyostelium discoideum GN=ndrB PE=3 SV=1 232 569 1.0E-58
sp|Q9XF67|PDPK1_ARATH 3-phosphoinositide-dependent protein kinase 1 OS=Arabidopsis thaliana GN=PDPK1 PE=1 SV=1 244 554 3.0E-58
sp|P18653|KS6A1_MOUSE Ribosomal protein S6 kinase alpha-1 OS=Mus musculus GN=Rps6ka1 PE=1 SV=1 212 562 5.0E-58
sp|Q9Y2H1|ST38L_HUMAN Serine/threonine-protein kinase 38-like OS=Homo sapiens GN=STK38L PE=1 SV=3 232 569 7.0E-58
sp|Q6AX33|MAST3_XENLA Microtubule-associated serine/threonine-protein kinase 3 OS=Xenopus laevis GN=mast3 PE=2 SV=1 242 562 8.0E-58
sp|Q5F3L1|KS6A5_CHICK Ribosomal protein S6 kinase alpha-5 OS=Gallus gallus GN=RPS6KA5 PE=2 SV=1 238 562 9.0E-58
sp|P16054|KPCE_MOUSE Protein kinase C epsilon type OS=Mus musculus GN=Prkce PE=1 SV=1 239 562 1.0E-57
sp|O60307|MAST3_HUMAN Microtubule-associated serine/threonine-protein kinase 3 OS=Homo sapiens GN=MAST3 PE=1 SV=2 242 562 1.0E-57
sp|Q7TSE6|ST38L_MOUSE Serine/threonine-protein kinase 38-like OS=Mus musculus GN=Stk38l PE=1 SV=2 232 569 2.0E-57
sp|P34885|KPC1B_CAEEL Protein kinase C-like 1B OS=Caenorhabditis elegans GN=pkc-1 PE=2 SV=2 226 562 2.0E-57
sp|P10830|KPCE_RABIT Protein kinase C epsilon type OS=Oryctolagus cuniculus GN=PRKCE PE=2 SV=1 239 562 2.0E-57
sp|Q02156|KPCE_HUMAN Protein kinase C epsilon type OS=Homo sapiens GN=PRKCE PE=1 SV=1 239 562 2.0E-57
sp|Q3U214|MAST3_MOUSE Microtubule-associated serine/threonine-protein kinase 3 OS=Mus musculus GN=Mast3 PE=1 SV=3 242 567 4.0E-57
sp|Q7TSJ6|LATS2_MOUSE Serine/threonine-protein kinase LATS2 OS=Mus musculus GN=Lats2 PE=1 SV=1 229 614 5.0E-57
sp|Q60592|MAST2_MOUSE Microtubule-associated serine/threonine-protein kinase 2 OS=Mus musculus GN=Mast2 PE=1 SV=1 244 562 7.0E-57
sp|Q9Z2A0|PDPK1_MOUSE 3-phosphoinositide-dependent protein kinase 1 OS=Mus musculus GN=Pdpk1 PE=1 SV=2 241 548 7.0E-57
sp|O55173|PDPK1_RAT 3-phosphoinositide-dependent protein kinase 1 OS=Rattus norvegicus GN=Pdpk1 PE=1 SV=2 241 548 9.0E-57
sp|Q5R4K9|KPCI_PONAB Protein kinase C iota type OS=Pongo abelii GN=PRKCI PE=2 SV=2 239 574 1.0E-56
sp|Q8BYR2|LATS1_MOUSE Serine/threonine-protein kinase LATS1 OS=Mus musculus GN=Lats1 PE=1 SV=3 229 565 1.0E-56
sp|P41743|KPCI_HUMAN Protein kinase C iota type OS=Homo sapiens GN=PRKCI PE=1 SV=2 239 574 1.0E-56
sp|P05130|KPC1_DROME Protein kinase C, brain isozyme OS=Drosophila melanogaster GN=Pkc53E PE=2 SV=2 204 574 1.0E-56
sp|P09216|KPCE_RAT Protein kinase C epsilon type OS=Rattus norvegicus GN=Prkce PE=1 SV=1 239 562 1.0E-56
sp|F1M7Y5|KPCI_RAT Protein kinase C iota type OS=Rattus norvegicus GN=Prkci PE=1 SV=1 239 574 1.0E-56
sp|O45797|WARTS_CAEEL Serine/threonine-protein kinase WARTS homolog OS=Caenorhabditis elegans GN=wts-1 PE=1 SV=1 218 572 1.0E-56
sp|Q6P0Q8|MAST2_HUMAN Microtubule-associated serine/threonine-protein kinase 2 OS=Homo sapiens GN=MAST2 PE=1 SV=2 244 562 1.0E-56
sp|Q62074|KPCI_MOUSE Protein kinase C iota type OS=Mus musculus GN=Prkci PE=1 SV=3 239 574 1.0E-56
sp|Q5R4K3|KS6A5_PONAB Ribosomal protein S6 kinase alpha-5 OS=Pongo abelii GN=RPS6KA5 PE=2 SV=1 239 562 2.0E-56
sp|Q6A1A2|PDPK2_HUMAN Putative 3-phosphoinositide-dependent protein kinase 2 OS=Homo sapiens GN=PDPK2P PE=5 SV=1 248 548 3.0E-56
sp|P54265|DMPK_MOUSE Myotonin-protein kinase OS=Mus musculus GN=Dmpk PE=1 SV=1 223 606 4.0E-56
sp|P92199|ROCK_CAEEL Rho-associated protein kinase let-502 OS=Caenorhabditis elegans GN=let-502 PE=1 SV=1 237 566 4.0E-56
sp|P34103|PK4_DICDI Protein kinase 4 (Fragment) OS=Dictyostelium discoideum GN=pkgD PE=3 SV=2 242 551 5.0E-56
sp|Q9NRM7|LATS2_HUMAN Serine/threonine-protein kinase LATS2 OS=Homo sapiens GN=LATS2 PE=1 SV=2 229 567 6.0E-56
sp|Q90XF2|KPCI_DANRE Protein kinase C iota type OS=Danio rerio GN=prkci PE=2 SV=2 239 552 6.0E-56
sp|O95835|LATS1_HUMAN Serine/threonine-protein kinase LATS1 OS=Homo sapiens GN=LATS1 PE=1 SV=1 229 565 6.0E-56
sp|P87253|KPC1_NEUCR Protein kinase C-like OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU06544 PE=3 SV=2 237 562 6.0E-56
sp|P40376|KAPB_SCHPO cAMP-dependent protein kinase catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pka1 PE=1 SV=1 240 551 7.0E-56
sp|O15530|PDPK1_HUMAN 3-phosphoinositide-dependent protein kinase 1 OS=Homo sapiens GN=PDPK1 PE=1 SV=1 248 548 8.0E-56
sp|A8XJL7|SAX1_CAEBR Serine/threonine-protein kinase sax-1 OS=Caenorhabditis briggsae GN=sax-1 PE=3 SV=2 229 562 1.0E-55
sp|A8WVU9|ROCK_CAEBR Rho-associated protein kinase let-502 OS=Caenorhabditis briggsae GN=let-502 PE=3 SV=2 237 566 1.0E-55
sp|Q5VT25|MRCKA_HUMAN Serine/threonine-protein kinase MRCK alpha OS=Homo sapiens GN=CDC42BPA PE=1 SV=1 233 562 1.0E-55
sp|O75582|KS6A5_HUMAN Ribosomal protein S6 kinase alpha-5 OS=Homo sapiens GN=RPS6KA5 PE=1 SV=1 238 562 1.0E-55
sp|Q54IF2|Y0670_DICDI Probable serine/threonine-protein kinase DDB_G0288795 OS=Dictyostelium discoideum GN=DDB_G0288795 PE=2 SV=1 238 552 1.0E-55
sp|Q02111|KPCT_MOUSE Protein kinase C theta type OS=Mus musculus GN=Prkcq PE=1 SV=1 216 562 1.0E-55
sp|Q16975|KPC2_APLCA Calcium-independent protein kinase C OS=Aplysia californica GN=PRKC2 PE=1 SV=1 244 562 1.0E-55
sp|Q9Y5S2|MRCKB_HUMAN Serine/threonine-protein kinase MRCK beta OS=Homo sapiens GN=CDC42BPB PE=1 SV=2 234 562 1.0E-55
sp|Q9VA38|WARTS_DROME Serine/threonine-protein kinase Warts OS=Drosophila melanogaster GN=wts PE=1 SV=1 216 565 2.0E-55
sp|O01583|MRCK_CAEEL Serine/threonine-protein kinase mrck-1 OS=Caenorhabditis elegans GN=mrck-1 PE=2 SV=3 233 562 2.0E-55
sp|Q10364|SCK2_SCHPO Serine/threonine-protein kinase sck2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sck2 PE=3 SV=1 240 562 3.0E-55
sp|Q7TT50|MRCKB_MOUSE Serine/threonine-protein kinase MRCK beta OS=Mus musculus GN=Cdc42bpb PE=1 SV=2 234 605 3.0E-55
sp|P23298|KPCL_MOUSE Protein kinase C eta type OS=Mus musculus GN=Prkch PE=1 SV=2 240 562 3.0E-55
sp|Q7TT49|MRCKB_RAT Serine/threonine-protein kinase MRCK beta OS=Rattus norvegicus GN=Cdc42bpb PE=1 SV=1 234 605 4.0E-55
sp|Q99014|KPC1_HYPJE Protein kinase C-like OS=Hypocrea jecorina GN=pkc1 PE=3 SV=1 239 562 5.0E-55
sp|Q9XTG7|AKT2_CAEEL Serine/threonine-protein kinase akt-2 OS=Caenorhabditis elegans GN=akt-2 PE=1 SV=1 235 562 6.0E-55
sp|Q3UU96|MRCKA_MOUSE Serine/threonine-protein kinase MRCK alpha OS=Mus musculus GN=Cdc42bpa PE=1 SV=2 233 562 7.0E-55
sp|Q8C050|KS6A5_MOUSE Ribosomal protein S6 kinase alpha-5 OS=Mus musculus GN=Rps6ka5 PE=1 SV=2 238 562 8.0E-55
sp|Q64617|KPCL_RAT Protein kinase C eta type OS=Rattus norvegicus GN=Prkch PE=1 SV=1 240 562 1.0E-54
sp|Q2L6W9|SAX1_CAEEL Serine/threonine-protein kinase sax-1 OS=Caenorhabditis elegans GN=sax-1 PE=2 SV=1 229 562 2.0E-54
sp|P24723|KPCL_HUMAN Protein kinase C eta type OS=Homo sapiens GN=PRKCH PE=1 SV=4 239 562 2.0E-54
sp|O54874|MRCKA_RAT Serine/threonine-protein kinase MRCK alpha OS=Rattus norvegicus GN=Cdc42bpa PE=1 SV=1 233 562 2.0E-54
sp|Q09013|DMPK_HUMAN Myotonin-protein kinase OS=Homo sapiens GN=DMPK PE=1 SV=3 232 575 3.0E-54
sp|P90980|KPC2_CAEEL Protein kinase C-like 2 OS=Caenorhabditis elegans GN=pkc-2 PE=2 SV=2 239 562 3.0E-54
sp|Q00078|KPC1_ASPNG Protein kinase C-like OS=Aspergillus niger GN=pkcA PE=3 SV=1 205 562 3.0E-54
sp|Q04759|KPCT_HUMAN Protein kinase C theta type OS=Homo sapiens GN=PRKCQ PE=1 SV=3 248 562 4.0E-54
sp|O42632|KPC1_COCHE Protein kinase C-like OS=Cochliobolus heterostrophus GN=PKC1 PE=3 SV=1 239 562 5.0E-54
sp|P09217|KPCZ_RAT Protein kinase C zeta type OS=Rattus norvegicus GN=Prkcz PE=1 SV=2 239 574 8.0E-54
sp|Q05513|KPCZ_HUMAN Protein kinase C zeta type OS=Homo sapiens GN=PRKCZ PE=1 SV=4 239 574 9.0E-54
sp|Q9WTQ0|KPCT_RAT Protein kinase C theta type OS=Rattus norvegicus GN=Prkcq PE=1 SV=2 248 562 9.0E-54
sp|P83099|KPC4_DROME Putative protein kinase C delta type homolog OS=Drosophila melanogaster GN=Pkcdelta PE=2 SV=3 244 574 1.0E-53
sp|Q02956|KPCZ_MOUSE Protein kinase C zeta type OS=Mus musculus GN=Prkcz PE=1 SV=2 239 574 1.0E-53
sp|P36583|PCK2_SCHPO Protein kinase C-like 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pck2 PE=1 SV=2 204 562 1.0E-53
sp|P13677|KPC2_DROME Protein kinase C, eye isozyme OS=Drosophila melanogaster GN=inaC PE=1 SV=1 242 574 1.0E-53
sp|Q54PK9|PDPKB_DICDI 3-phosphoinositide-dependent protein kinase B OS=Dictyostelium discoideum GN=pdkB PE=3 SV=1 242 602 2.0E-53
sp|Q6DT37|MRCKG_HUMAN Serine/threonine-protein kinase MRCK gamma OS=Homo sapiens GN=CDC42BPG PE=1 SV=2 233 562 2.0E-53
sp|P24583|KPC1_YEAST Protein kinase C-like 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKC1 PE=1 SV=3 238 562 3.0E-53
sp|O19111|KPCZ_RABIT Protein kinase C zeta type OS=Oryctolagus cuniculus GN=PRKCZ PE=2 SV=1 239 552 4.0E-53
sp|Q5R8M1|STK38_PONAB Serine/threonine-protein kinase 38 OS=Pongo abelii GN=STK38 PE=2 SV=1 232 569 5.0E-53
sp|Q15208|STK38_HUMAN Serine/threonine-protein kinase 38 OS=Homo sapiens GN=STK38 PE=1 SV=1 232 569 5.0E-53
sp|Q16974|KPC1_APLCA Calcium-dependent protein kinase C OS=Aplysia californica GN=PRKC1 PE=1 SV=2 233 574 5.0E-53
sp|Q8BWW9|PKN2_MOUSE Serine/threonine-protein kinase N2 OS=Mus musculus GN=Pkn2 PE=1 SV=3 53 604 8.0E-53
sp|Q5PU49|KPCD_CANLF Protein kinase C delta type OS=Canis lupus familiaris GN=PRKCD PE=2 SV=1 248 562 8.0E-53
sp|Q80UW5|MRCKG_MOUSE Serine/threonine-protein kinase MRCK gamma OS=Mus musculus GN=Cdc42bpg PE=1 SV=2 233 562 8.0E-53
sp|A2VDV2|STK38_BOVIN Serine/threonine-protein kinase 38 OS=Bos taurus GN=STK38 PE=2 SV=1 232 569 1.0E-52
sp|A1Z9X0|APKC_DROME Atypical protein kinase C OS=Drosophila melanogaster GN=aPKC PE=1 SV=1 242 562 3.0E-52
sp|Q91VJ4|STK38_MOUSE Serine/threonine-protein kinase 38 OS=Mus musculus GN=Stk38 PE=1 SV=1 232 569 4.0E-52
sp|Q18846|KS6A2_CAEEL Putative ribosomal protein S6 kinase alpha-2 OS=Caenorhabditis elegans GN=rskn-2 PE=3 SV=2 238 562 5.0E-52
sp|O94487|PPK35_SCHPO Serine/threonine-protein kinase ppk35 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk35 PE=1 SV=1 232 572 7.0E-52
sp|A8KBH6|KPCB_XENTR Protein kinase C beta type OS=Xenopus tropicalis GN=prkcb PE=2 SV=1 242 551 9.0E-52
sp|Q54HD2|NDRD_DICDI Probable serine/threonine-protein kinase ndrD OS=Dictyostelium discoideum GN=ndrD PE=3 SV=1 217 569 1.0E-51
sp|P36582|PCK1_SCHPO Protein kinase C-like 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pck1 PE=3 SV=2 244 539 1.0E-51
sp|Q559T8|Y0701_DICDI Probable serine/threonine-protein kinase DDB_G0272282 OS=Dictyostelium discoideum GN=DDB_G0272282 PE=3 SV=1 242 562 1.0E-51
sp|Q9V3I5|JIL1_DROME Chromosomal serine/threonine-protein kinase JIL-1 OS=Drosophila melanogaster GN=JIL-1 PE=1 SV=1 239 579 2.0E-51
sp|O08874|PKN2_RAT Serine/threonine-protein kinase N2 OS=Rattus norvegicus GN=Pkn2 PE=1 SV=2 244 604 3.0E-51
sp|Q16513|PKN2_HUMAN Serine/threonine-protein kinase N2 OS=Homo sapiens GN=PKN2 PE=1 SV=1 244 570 4.0E-51
sp|P09215|KPCD_RAT Protein kinase C delta type OS=Rattus norvegicus GN=Prkcd PE=1 SV=1 248 562 5.0E-51
sp|A1Z7T0|PKN_DROME Serine/threonine-protein kinase N OS=Drosophila melanogaster GN=Pkn PE=1 SV=1 243 574 6.0E-51
sp|Q25378|KPC1_LYTPI Protein kinase C OS=Lytechinus pictus GN=PKC1 PE=2 SV=1 228 610 8.0E-51
sp|Q63433|PKN1_RAT Serine/threonine-protein kinase N1 OS=Rattus norvegicus GN=Pkn1 PE=1 SV=2 244 562 1.0E-50
sp|A7MBL8|PKN2_DANRE Serine/threonine-protein kinase N2 OS=Danio rerio GN=pkn2 PE=2 SV=1 237 604 1.0E-50
sp|P04409|KPCA_BOVIN Protein kinase C alpha type OS=Bos taurus GN=PRKCA PE=1 SV=3 168 551 1.0E-50
sp|P0C605|KGP1_MOUSE cGMP-dependent protein kinase 1 OS=Mus musculus GN=Prkg1 PE=1 SV=1 242 567 1.0E-50
sp|Q7SY24|KPCB_DANRE Protein kinase C beta type OS=Danio rerio GN=prkcbb PE=2 SV=1 242 562 1.0E-50
sp|O77676|KGP1_RABIT cGMP-dependent protein kinase 1 OS=Oryctolagus cuniculus GN=PRKG1 PE=1 SV=3 242 562 1.0E-50
sp|Q13976|KGP1_HUMAN cGMP-dependent protein kinase 1 OS=Homo sapiens GN=PRKG1 PE=1 SV=3 242 567 1.0E-50
sp|P00516|KGP1_BOVIN cGMP-dependent protein kinase 1 OS=Bos taurus GN=PRKG1 PE=1 SV=2 242 567 1.0E-50
sp|P34722|KPC1_CAEEL Protein kinase C-like 1 OS=Caenorhabditis elegans GN=tpa-1 PE=1 SV=2 244 562 2.0E-50
sp|P20444|KPCA_MOUSE Protein kinase C alpha type OS=Mus musculus GN=Prkca PE=1 SV=3 239 551 2.0E-50
sp|Q7LZQ8|KPCB_XENLA Protein kinase C beta type OS=Xenopus laevis GN=prkcb PE=2 SV=1 242 551 2.0E-50
sp|P28867|KPCD_MOUSE Protein kinase C delta type OS=Mus musculus GN=Prkcd PE=1 SV=3 248 562 2.0E-50
sp|P10102|KPCA_RABIT Protein kinase C alpha type OS=Oryctolagus cuniculus GN=PRKCA PE=2 SV=3 239 551 2.0E-50
sp|O14578|CTRO_HUMAN Citron Rho-interacting kinase OS=Homo sapiens GN=CIT PE=1 SV=2 176 602 3.0E-50
sp|Q16512|PKN1_HUMAN Serine/threonine-protein kinase N1 OS=Homo sapiens GN=PKN1 PE=1 SV=2 244 562 3.0E-50
sp|P05696|KPCA_RAT Protein kinase C alpha type OS=Rattus norvegicus GN=Prkca PE=1 SV=3 239 551 3.0E-50
sp|A1A4I4|PKN1_BOVIN Serine/threonine-protein kinase N1 OS=Bos taurus GN=PKN1 PE=2 SV=1 244 562 3.0E-50
sp|P68403|KPCB_RAT Protein kinase C beta type OS=Rattus norvegicus GN=Prkcb PE=1 SV=3 242 574 3.0E-50
sp|P68404|KPCB_MOUSE Protein kinase C beta type OS=Mus musculus GN=Prkcb PE=1 SV=4 242 574 3.0E-50
sp|P05771|KPCB_HUMAN Protein kinase C beta type OS=Homo sapiens GN=PRKCB PE=1 SV=4 242 562 4.0E-50
sp|P17252|KPCA_HUMAN Protein kinase C alpha type OS=Homo sapiens GN=PRKCA PE=1 SV=4 239 551 4.0E-50
sp|P05126|KPCB_BOVIN Protein kinase C beta type OS=Bos taurus GN=PRKCB PE=2 SV=4 242 574 4.0E-50
sp|P05772|KPCB_RABIT Protein kinase C beta type OS=Oryctolagus cuniculus GN=PRKCB PE=2 SV=3 242 574 4.0E-50
sp|P32023|KGP25_DROME cGMP-dependent protein kinase, isozyme 2 forms cD5/T2 OS=Drosophila melanogaster GN=for PE=2 SV=3 247 562 5.0E-50
sp|Q05655|KPCD_HUMAN Protein kinase C delta type OS=Homo sapiens GN=PRKCD PE=1 SV=2 248 576 6.0E-50
sp|Q9W1B0|GEK_DROME Serine/threonine-protein kinase Genghis Khan OS=Drosophila melanogaster GN=gek PE=1 SV=1 234 601 7.0E-50
sp|P70268|PKN1_MOUSE Serine/threonine-protein kinase N1 OS=Mus musculus GN=Pkn1 PE=1 SV=3 244 562 1.0E-49
sp|Q03043|KGP24_DROME cGMP-dependent protein kinase, isozyme 2 forms cD4/T1/T3A/T3B OS=Drosophila melanogaster GN=for PE=1 SV=3 247 562 1.0E-49
sp|O43930|PRKY_HUMAN Putative serine/threonine-protein kinase PRKY OS=Homo sapiens GN=PRKY PE=5 SV=1 245 493 2.0E-49
sp|Q6P5Z2|PKN3_HUMAN Serine/threonine-protein kinase N3 OS=Homo sapiens GN=PKN3 PE=1 SV=1 244 551 3.0E-49
sp|Q61410|KGP2_MOUSE cGMP-dependent protein kinase 2 OS=Mus musculus GN=Prkg2 PE=1 SV=1 242 555 9.0E-49
sp|Q13237|KGP2_HUMAN cGMP-dependent protein kinase 2 OS=Homo sapiens GN=PRKG2 PE=1 SV=1 242 549 3.0E-48
sp|P43057|KPC1_CANAX Protein kinase C-like 1 OS=Candida albicans GN=PKC1 PE=3 SV=1 221 605 5.0E-48
sp|Q09898|SID2_SCHPO Serine/threonine-protein kinase sid2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sid2 PE=1 SV=1 232 562 5.0E-48
sp|Q64595|KGP2_RAT cGMP-dependent protein kinase 2 OS=Rattus norvegicus GN=Prkg2 PE=1 SV=1 242 555 7.0E-48
sp|Q54L81|Y0700_DICDI Probable serine/threonine-protein kinase DDB_G0286841 OS=Dictyostelium discoideum GN=DDB_G0286841 PE=3 SV=1 228 567 7.0E-48
sp|Q8K045|PKN3_MOUSE Serine/threonine-protein kinase N3 OS=Mus musculus GN=Pkn3 PE=1 SV=1 244 551 9.0E-48
sp|P22204|DBF2_YEAST Cell cycle protein kinase DBF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBF2 PE=1 SV=3 232 601 1.0E-47
sp|P38070|YPK3_YEAST AGC kinase YPK3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK3 PE=1 SV=1 244 551 9.0E-47
sp|P05129|KPCG_HUMAN Protein kinase C gamma type OS=Homo sapiens GN=PRKCG PE=1 SV=3 242 553 2.0E-46
sp|P10829|KPCG_RABIT Protein kinase C gamma type OS=Oryctolagus cuniculus GN=PRKCG PE=1 SV=1 242 553 5.0E-46
sp|P63319|KPCG_RAT Protein kinase C gamma type OS=Rattus norvegicus GN=Prkcg PE=1 SV=1 242 553 6.0E-46
sp|P63318|KPCG_MOUSE Protein kinase C gamma type OS=Mus musculus GN=Prkcg PE=1 SV=1 242 553 6.0E-46
sp|Q54P47|NDRC_DICDI Probable serine/threonine-protein kinase ndrC OS=Dictyostelium discoideum GN=ndrC PE=3 SV=1 244 570 7.0E-46
sp|Q03042|KGP1_DROME cGMP-dependent protein kinase, isozyme 1 OS=Drosophila melanogaster GN=Pkg21D PE=1 SV=2 242 550 9.0E-46
sp|P49025|CTRO_MOUSE Citron Rho-interacting kinase OS=Mus musculus GN=Cit PE=1 SV=3 176 602 1.0E-45
sp|Q8SRK8|KAPC_ENCCU Probable cAMP-dependent protein kinase catalytic subunit OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU07_0520 PE=3 SV=1 244 553 1.0E-45
sp|P05128|KPCG_BOVIN Protein kinase C gamma type (Fragment) OS=Bos taurus GN=PRKCG PE=2 SV=1 242 553 1.0E-45
sp|A8X6H1|EGL4_CAEBR cGMP-dependent protein kinase egl-4 OS=Caenorhabditis briggsae GN=egl-4 PE=3 SV=2 216 564 2.0E-45
sp|O64629|AUR3_ARATH Serine/threonine-protein kinase Aurora-3 OS=Arabidopsis thaliana GN=AUR3 PE=2 SV=1 250 534 2.0E-45
sp|Q62833|GRK5_RAT G protein-coupled receptor kinase 5 OS=Rattus norvegicus GN=Grk5 PE=2 SV=1 239 584 3.0E-45
sp|Q4R4U2|KPCG_MACFA Protein kinase C gamma type OS=Macaca fascicularis GN=PRKCG PE=2 SV=1 242 553 1.0E-44
sp|P16911|KDC1_DROME Protein kinase DC1 OS=Drosophila melanogaster GN=Pka-C2 PE=2 SV=1 249 573 1.0E-44
sp|P43249|GRK5_BOVIN G protein-coupled receptor kinase 5 OS=Bos taurus GN=GRK5 PE=1 SV=1 239 584 4.0E-44
sp|Q54UZ1|Y1639_DICDI Probable serine/threonine-protein kinase DDB_G0280717 OS=Dictyostelium discoideum GN=DDB_G0280717 PE=3 SV=1 247 542 4.0E-44
sp|O76360|EGL4_CAEEL cGMP-dependent protein kinase egl-4 OS=Caenorhabditis elegans GN=egl-4 PE=1 SV=2 216 564 4.0E-44
sp|Q8VEB1|GRK5_MOUSE G protein-coupled receptor kinase 5 OS=Mus musculus GN=Grk5 PE=1 SV=2 239 584 4.0E-44
sp|P34947|GRK5_HUMAN G protein-coupled receptor kinase 5 OS=Homo sapiens GN=GRK5 PE=1 SV=1 239 584 5.0E-44
sp|Q09639|GRK2_CAEEL G protein-coupled receptor kinase 2 OS=Caenorhabditis elegans GN=grk-2 PE=3 SV=2 236 586 6.0E-44
sp|Q9NY57|ST32B_HUMAN Serine/threonine-protein kinase 32B OS=Homo sapiens GN=STK32B PE=2 SV=1 236 555 1.0E-43
sp|Q86UX6|ST32C_HUMAN Serine/threonine-protein kinase 32C OS=Homo sapiens GN=STK32C PE=1 SV=1 244 555 1.0E-43
sp|P32328|DBF20_YEAST Serine/threonine-protein kinase DBF20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBF20 PE=1 SV=2 232 601 2.0E-43
sp|Q753D9|PKH3_ASHGO Serine/threonine-protein kinase PKH3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PKH3 PE=3 SV=1 250 539 2.0E-43
sp|Q8BGW6|ST32A_MOUSE Serine/threonine-protein kinase 32A OS=Mus musculus GN=Stk32a PE=2 SV=1 236 555 4.0E-43
sp|A8WUG4|KPC3_CAEBR Protein kinase C-like 3 OS=Caenorhabditis briggsae GN=pkc-3 PE=3 SV=1 239 551 4.0E-43
sp|Q19266|KPC3_CAEEL Protein kinase C-like 3 OS=Caenorhabditis elegans GN=pkc-3 PE=1 SV=1 239 551 2.0E-42
sp|Q8QZV4|ST32C_MOUSE Serine/threonine-protein kinase 32C OS=Mus musculus GN=Stk32c PE=1 SV=1 238 555 3.0E-42
sp|Q03407|PKH1_YEAST Serine/threonine-protein kinase PKH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH1 PE=1 SV=1 237 534 3.0E-42
sp|Q9JJX8|ST32B_MOUSE Serine/threonine-protein kinase 32B OS=Mus musculus GN=Stk32b PE=2 SV=2 236 555 5.0E-42
sp|Q8WU08|ST32A_HUMAN Serine/threonine-protein kinase 32A OS=Homo sapiens GN=STK32A PE=1 SV=2 236 555 5.0E-42
sp|Q03306|PKH3_YEAST Serine/threonine-protein kinase PKH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH3 PE=1 SV=1 250 539 5.0E-42
sp|Q59KM8|DBF2_CANAL Cell cycle protein kinase DBF2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBF2 PE=2 SV=1 232 571 2.0E-41
sp|Q12236|PKH2_YEAST Serine/threonine-protein kinase PKH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH2 PE=1 SV=1 237 535 8.0E-41
sp|Q9Y7J6|PPK21_SCHPO Serine/threonine-protein kinase ppk21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk21 PE=1 SV=3 249 548 9.0E-41
sp|Q99MK8|ARBK1_MOUSE Beta-adrenergic receptor kinase 1 OS=Mus musculus GN=Adrbk1 PE=1 SV=2 236 554 1.0E-40
sp|Q9VKN7|AURKB_DROME Aurora kinase B OS=Drosophila melanogaster GN=ial PE=1 SV=1 241 519 1.0E-40
sp|Q8WP15|GRK7_PIG G protein-coupled receptor kinase 7 OS=Sus scrofa GN=GRK7 PE=1 SV=1 227 584 1.0E-40
sp|Q54WX4|AURK_DICDI Aurora kinase OS=Dictyostelium discoideum GN=aurK PE=1 SV=1 244 535 2.0E-40
sp|P26817|ARBK1_RAT Beta-adrenergic receptor kinase 1 OS=Rattus norvegicus GN=Adrbk1 PE=1 SV=1 236 554 2.0E-40
sp|P21901|KAPL_APLCA Spermatozoon-associated protein kinase OS=Aplysia californica PE=2 SV=1 223 571 3.0E-40
sp|P25098|ARBK1_HUMAN Beta-adrenergic receptor kinase 1 OS=Homo sapiens GN=ADRBK1 PE=1 SV=2 223 554 3.0E-40
sp|Q755C4|IPL1_ASHGO Spindle assembly checkpoint kinase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IPL1 PE=3 SV=1 233 534 3.0E-40
sp|P21146|ARBK1_BOVIN Beta-adrenergic receptor kinase 1 OS=Bos taurus GN=ADRBK1 PE=1 SV=1 223 554 4.0E-40
sp|Q64FQ2|PID2_ARATH Protein kinase PINOID 2 OS=Arabidopsis thaliana GN=PID2 PE=1 SV=1 239 395 4.0E-40
sp|Q94E49|PID2_ORYSJ Protein kinase PINOID 2 OS=Oryza sativa subsp. japonica GN=PID2 PE=2 SV=1 239 395 8.0E-40
sp|Q6FV07|IPL1_CANGA Spindle assembly checkpoint kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=IPL1 PE=3 SV=1 198 534 9.0E-40
sp|Q683C9|AUR2_ARATH Serine/threonine-protein kinase Aurora-2 OS=Arabidopsis thaliana GN=AUR2 PE=2 SV=2 242 520 1.0E-39
sp|Q9N0X0|AURKB_PIG Aurora kinase B OS=Sus scrofa GN=AURKB PE=2 SV=2 227 552 1.0E-39
sp|Q9Z2G7|GRK7_ICTTR G protein-coupled receptor kinase 7 OS=Ictidomys tridecemlineatus GN=GRK7 PE=1 SV=1 79 584 1.0E-39
sp|Q7YRC6|AURKB_BOVIN Aurora kinase B OS=Bos taurus GN=AURKB PE=2 SV=1 244 552 2.0E-39
sp|Q6NW76|AURKB_DANRE Aurora kinase B OS=Danio rerio GN=aurkb PE=2 SV=1 244 549 3.0E-39
sp|Q622Z7|GRK1_CAEBR G protein-coupled receptor kinase 1 OS=Caenorhabditis briggsae GN=grk-1 PE=3 SV=1 221 585 3.0E-39
sp|Q64682|ARBK1_MESAU Beta-adrenergic receptor kinase 1 OS=Mesocricetus auratus GN=ADRBK1 PE=2 SV=1 236 554 3.0E-39
sp|Q8WMV0|GRK7_BOVIN G protein-coupled receptor kinase 7 OS=Bos taurus GN=GRK7 PE=1 SV=1 227 584 3.0E-39
sp|P43250|GRK6_HUMAN G protein-coupled receptor kinase 6 OS=Homo sapiens GN=GRK6 PE=1 SV=2 239 584 4.0E-39
sp|Q9M077|AUR1_ARATH Serine/threonine-protein kinase Aurora-1 OS=Arabidopsis thaliana GN=AUR1 PE=1 SV=1 242 519 5.0E-39
sp|O97627|ARBK1_DIDVI Beta-adrenergic receptor kinase 1 OS=Didelphis virginiana GN=ADRBK1 PE=1 SV=1 236 554 5.0E-39
sp|Q59S66|IPL1_CANAL Spindle assembly checkpoint kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=IPL1 PE=3 SV=1 244 522 6.0E-39
sp|P32866|GPRK2_DROME G protein-coupled receptor kinase 2 OS=Drosophila melanogaster GN=Gprk2 PE=1 SV=3 219 585 6.0E-39
sp|Q91820|AURAA_XENLA Aurora kinase A-A OS=Xenopus laevis GN=aurka-a PE=1 SV=1 244 534 7.0E-39
sp|P34100|PKD1_DICDI Developmentally-regulated protein kinase 1 OS=Dictyostelium discoideum GN=pkaD PE=2 SV=2 242 539 7.0E-39
sp|Q91819|AURAB_XENLA Aurora kinase A-B OS=Xenopus laevis GN=aurka-b PE=2 SV=3 244 534 8.0E-39
sp|P26819|ARBK2_RAT Beta-adrenergic receptor kinase 2 OS=Rattus norvegicus GN=Adrbk2 PE=2 SV=1 236 554 2.0E-38
sp|P26818|ARBK2_BOVIN Beta-adrenergic receptor kinase 2 OS=Bos taurus GN=ADRBK2 PE=2 SV=1 236 554 2.0E-38
sp|Q5A3P6|PKH2_CANAL Serine/threonine-protein kinase PKH2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PKH2 PE=1 SV=1 248 539 2.0E-38
sp|Q3UYH7|ARBK2_MOUSE Beta-adrenergic receptor kinase 2 OS=Mus musculus GN=Adrbk2 PE=1 SV=2 236 554 3.0E-38
sp|O55099|AURKB_RAT Aurora kinase B OS=Rattus norvegicus GN=Aurkb PE=1 SV=1 220 548 3.0E-38
sp|P32865|GPRK1_DROME G protein-coupled receptor kinase 1 OS=Drosophila melanogaster GN=Gprk1 PE=2 SV=2 236 554 4.0E-38
sp|O70126|AURKB_MOUSE Aurora kinase B OS=Mus musculus GN=Aurkb PE=1 SV=2 241 548 5.0E-38
sp|O70293|GRK6_MOUSE G protein-coupled receptor kinase 6 OS=Mus musculus GN=Grk6 PE=1 SV=1 239 584 1.0E-37
sp|Q09537|GRK1_CAEEL G protein-coupled receptor kinase 1 OS=Caenorhabditis elegans GN=grk-1 PE=3 SV=1 220 585 2.0E-37
sp|P35626|ARBK2_HUMAN Beta-adrenergic receptor kinase 2 OS=Homo sapiens GN=ADRBK2 PE=1 SV=2 236 554 2.0E-37
sp|P28327|RK_BOVIN Rhodopsin kinase OS=Bos taurus GN=GRK1 PE=1 SV=1 193 584 2.0E-37
sp|Q6C3J2|IPL1_YARLI Spindle assembly checkpoint kinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IPL1 PE=3 SV=1 215 534 3.0E-37
sp|Q8SRL5|IPL1_ENCCU Probable spindle assembly checkpoint kinase homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=IPL1 PE=3 SV=1 244 558 3.0E-37
sp|Q8WTQ7|GRK7_HUMAN G protein-coupled receptor kinase 7 OS=Homo sapiens GN=GRK7 PE=1 SV=1 227 584 3.0E-37
sp|P97711|GRK6_RAT G protein-coupled receptor kinase 6 OS=Rattus norvegicus GN=Grk6 PE=2 SV=1 239 584 4.0E-37
sp|P97477|AURKA_MOUSE Aurora kinase A OS=Mus musculus GN=Aurka PE=1 SV=1 244 535 4.0E-37
sp|Q12701|KSG1_SCHPO Serine/threonine-protein kinase ksg1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ksg1 PE=1 SV=2 242 541 5.0E-37
sp|Q6CWQ4|IPL1_KLULA Spindle assembly checkpoint kinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IPL1 PE=3 SV=1 244 534 8.0E-37
sp|P32298|GRK4_HUMAN G protein-coupled receptor kinase 4 OS=Homo sapiens GN=GRK4 PE=1 SV=3 226 586 9.0E-37
sp|O70291|GRK4_MOUSE G protein-coupled receptor kinase 4 OS=Mus musculus GN=Grk4 PE=2 SV=2 226 585 2.0E-36
sp|Q9SEZ7|CIPKG_ARATH CBL-interacting serine/threonine-protein kinase 16 OS=Arabidopsis thaliana GN=CIPK16 PE=1 SV=1 244 535 3.0E-36
sp|B6CZ17|GRK7A_XENLA G protein-coupled receptor kinase 7A OS=Xenopus laevis GN=grk7-a PE=1 SV=1 239 553 3.0E-36
sp|O59790|ARK1_SCHPO Serine/threonine-protein kinase ark1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ark1 PE=1 SV=2 244 534 6.0E-36
sp|O01427|AIR2_CAEEL Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis elegans GN=air-2 PE=1 SV=2 250 543 6.0E-36
sp|D7UQM5|AURK_PATPE Aurora kinase OS=Patiria pectinifera GN=aur PE=1 SV=1 242 519 9.0E-36
sp|B6CZ18|GRK7B_XENLA G protein-coupled receptor kinase 7B OS=Xenopus laevis GN=grk7-b PE=1 SV=1 239 572 1.0E-35
sp|Q869W6|MYLKG_DICDI Probable myosin light chain kinase DDB_G0275057 OS=Dictyostelium discoideum GN=DDB_G0275057 PE=3 SV=1 248 528 1.0E-35
sp|P59241|AURKA_RAT Aurora kinase A OS=Rattus norvegicus GN=Aurka PE=1 SV=1 244 535 1.0E-35
sp|Q15835|RK_HUMAN Rhodopsin kinase OS=Homo sapiens GN=GRK1 PE=1 SV=1 239 584 2.0E-35
sp|O62846|KAPCG_MACMU cAMP-dependent protein kinase catalytic subunit gamma (Fragment) OS=Macaca mulatta GN=PRKACG PE=2 SV=3 243 442 2.0E-35
sp|Q61XD3|AIR2_CAEBR Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis briggsae GN=air-2 PE=3 SV=1 250 518 3.0E-35
sp|P70507|GRK4_RAT G protein-coupled receptor kinase 4 OS=Rattus norvegicus GN=Grk4 PE=1 SV=1 226 585 5.0E-35
sp|Q501V0|KPSH1_DANRE Serine/threonine-protein kinase H1 homolog OS=Danio rerio GN=pskh1 PE=2 SV=2 242 521 6.0E-35
sp|Q6BVA0|IPL1_DEBHA Spindle assembly checkpoint kinase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=IPL1 PE=3 SV=2 244 538 8.0E-35
sp|Q64FQ2|PID2_ARATH Protein kinase PINOID 2 OS=Arabidopsis thaliana GN=PID2 PE=1 SV=1 425 551 1.0E-34
sp|P25323|MYLKA_DICDI Myosin light chain kinase A OS=Dictyostelium discoideum GN=mlkA PE=1 SV=2 250 536 1.0E-34
sp|Q6GPL3|AUKBB_XENLA Aurora kinase B-B OS=Xenopus laevis GN=aurkb-b PE=2 SV=1 244 549 1.0E-34
sp|O14965|AURKA_HUMAN Aurora kinase A OS=Homo sapiens GN=AURKA PE=1 SV=2 244 534 1.0E-34
sp|Q63651|RK_RAT Rhodopsin kinase OS=Rattus norvegicus GN=Grk1 PE=1 SV=1 239 584 2.0E-34
sp|Q6DE08|AUKBA_XENLA Aurora kinase B-A OS=Xenopus laevis GN=aurkb-a PE=1 SV=1 173 549 2.0E-34
sp|Q96GD4|AURKB_HUMAN Aurora kinase B OS=Homo sapiens GN=AURKB PE=1 SV=3 244 548 2.0E-34
sp|Q8BW96|KCC1D_MOUSE Calcium/calmodulin-dependent protein kinase type 1D OS=Mus musculus GN=Camk1d PE=1 SV=2 221 534 3.0E-34
sp|A5GFW1|AURKA_PIG Aurora kinase A OS=Sus scrofa GN=AURKA PE=3 SV=1 244 534 3.0E-34
sp|Q9LEU7|CIPK5_ARATH CBL-interacting serine/threonine-protein kinase 5 OS=Arabidopsis thaliana GN=CIPK5 PE=2 SV=1 248 549 3.0E-34
sp|Q2TA06|AURKA_BOVIN Aurora kinase A OS=Bos taurus GN=AURKA PE=2 SV=1 244 534 7.0E-34
sp|Q8IU85|KCC1D_HUMAN Calcium/calmodulin-dependent protein kinase type 1D OS=Homo sapiens GN=CAMK1D PE=1 SV=1 221 534 8.0E-34
sp|Q91YS8|KCC1A_MOUSE Calcium/calmodulin-dependent protein kinase type 1 OS=Mus musculus GN=Camk1 PE=1 SV=1 244 519 8.0E-34
sp|Q63450|KCC1A_RAT Calcium/calmodulin-dependent protein kinase type 1 OS=Rattus norvegicus GN=Camk1 PE=1 SV=2 244 519 9.0E-34
sp|A4IGM9|AURKB_XENTR Aurora kinase B OS=Xenopus tropicalis GN=aurkb PE=2 SV=1 244 549 1.0E-33
sp|Q9FJ55|CIPKJ_ARATH CBL-interacting serine/threonine-protein kinase 19 OS=Arabidopsis thaliana GN=CIPK19 PE=2 SV=1 248 517 2.0E-33
sp|Q9TW45|PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans GN=par-1 PE=1 SV=1 228 518 2.0E-33
sp|Q14012|KCC1A_HUMAN Calcium/calmodulin-dependent protein kinase type 1 OS=Homo sapiens GN=CAMK1 PE=1 SV=1 244 534 2.0E-33
sp|Q5QNM6|CIPKD_ORYSJ Putative CBL-interacting protein kinase 13 OS=Oryza sativa subsp. japonica GN=CIPK13 PE=3 SV=1 244 536 2.0E-33
sp|Q552E9|PKGA_DICDI Probable serine/threonine-protein kinase pkgA OS=Dictyostelium discoideum GN=pkgA PE=3 SV=1 242 392 3.0E-33
sp|A8WYE4|PAR1_CAEBR Serine/threonine-protein kinase par-1 OS=Caenorhabditis briggsae GN=par-1 PE=3 SV=1 235 518 3.0E-33
sp|Q0V7M1|KPSH1_BOVIN Serine/threonine-protein kinase H1 OS=Bos taurus GN=PSKH1 PE=2 SV=1 242 533 6.0E-33
sp|Q49HM9|GRK7A_DANRE G-protein-coupled receptor kinase 7A OS=Danio rerio GN=grk7a PE=1 SV=2 239 585 8.0E-33
sp|P11801|KPSH1_HUMAN Serine/threonine-protein kinase H1 OS=Homo sapiens GN=PSKH1 PE=1 SV=4 242 533 8.0E-33
sp|Q9WVL4|RK_MOUSE Rhodopsin kinase OS=Mus musculus GN=Grk1 PE=1 SV=1 239 584 9.0E-33
sp|Q8W1D5|CIPKP_ARATH CBL-interacting serine/threonine-protein kinase 25 OS=Arabidopsis thaliana GN=CIPK25 PE=2 SV=1 248 535 1.0E-32
sp|O88445|AURKC_MOUSE Aurora kinase C OS=Mus musculus GN=Aurkc PE=1 SV=1 250 550 1.0E-32
sp|Q96QS6|KPSH2_HUMAN Serine/threonine-protein kinase H2 OS=Homo sapiens GN=PSKH2 PE=2 SV=1 244 521 2.0E-32
sp|P38991|IPL1_YEAST Spindle assembly checkpoint kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IPL1 PE=1 SV=1 257 534 2.0E-32
sp|Q91YA2|KPSH1_MOUSE Serine/threonine-protein kinase H1 OS=Mus musculus GN=Pskh1 PE=2 SV=3 242 533 2.0E-32
sp|Q6ERS0|CIPKR_ORYSJ Putative CBL-interacting protein kinase 27 OS=Oryza sativa subsp. japonica GN=CIPK27 PE=3 SV=1 244 537 2.0E-32
sp|Q10LQ2|CIPKA_ORYSJ CBL-interacting protein kinase 10 OS=Oryza sativa subsp. japonica GN=CIPK10 PE=2 SV=1 231 536 3.0E-32
sp|Q9SN43|CIPKC_ARATH CBL-interacting serine/threonine-protein kinase 12 OS=Arabidopsis thaliana GN=CIPK12 PE=1 SV=1 248 491 3.0E-32
sp|Q9UQB9|AURKC_HUMAN Aurora kinase C OS=Homo sapiens GN=AURKC PE=1 SV=1 250 491 4.0E-32
sp|Q6NTJ3|GWL_XENLA Serine/threonine-protein kinase greatwall OS=Xenopus laevis GN=mastl PE=1 SV=1 244 392 4.0E-32
sp|Q5R7G9|NUAK2_PONAB NUAK family SNF1-like kinase 2 OS=Pongo abelii GN=NUAK2 PE=2 SV=1 186 554 5.0E-32
sp|Q9H093|NUAK2_HUMAN NUAK family SNF1-like kinase 2 OS=Homo sapiens GN=NUAK2 PE=1 SV=1 186 554 5.0E-32
sp|P0C8M8|CCR1_MAIZE Probable serine/threonine-protein kinase CCRP1 OS=Zea mays GN=CCRP1 PE=1 SV=1 233 535 5.0E-32
sp|Q7KZI7|MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens GN=MARK2 PE=1 SV=2 247 518 7.0E-32
sp|O08679|MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus GN=Mark2 PE=1 SV=1 247 518 8.0E-32
sp|Q94E49|PID2_ORYSJ Protein kinase PINOID 2 OS=Oryza sativa subsp. japonica GN=PID2 PE=2 SV=1 427 546 1.0E-31
sp|B1WAR9|GWL_XENTR Serine/threonine-protein kinase greatwall OS=Xenopus tropicalis GN=mastl PE=2 SV=1 244 392 1.0E-31
sp|P27448|MARK3_HUMAN MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens GN=MARK3 PE=1 SV=4 247 518 1.0E-31
sp|F4JY37|RUK_ARATH Serine/threonine-protein kinase RUNKEL OS=Arabidopsis thaliana GN=RUK PE=1 SV=1 250 536 1.0E-31
sp|Q66HE5|NUAK2_RAT NUAK family SNF1-like kinase 2 OS=Rattus norvegicus GN=Nuak2 PE=1 SV=1 205 534 2.0E-31
sp|Q54CY9|MYLKD_DICDI Probable myosin light chain kinase DDB_G0292624 OS=Dictyostelium discoideum GN=DDB_G0292624 PE=3 SV=1 248 569 2.0E-31
sp|Q8VHF0|MARK3_RAT MAP/microtubule affinity-regulating kinase 3 OS=Rattus norvegicus GN=Mark3 PE=1 SV=1 247 518 3.0E-31
sp|O70150|KCC1B_RAT Calcium/calmodulin-dependent protein kinase type 1B OS=Rattus norvegicus GN=Pnck PE=1 SV=1 250 519 3.0E-31
sp|Q05512|MARK2_MOUSE Serine/threonine-protein kinase MARK2 OS=Mus musculus GN=Mark2 PE=1 SV=3 247 518 3.0E-31
sp|Q96NX5|KCC1G_HUMAN Calcium/calmodulin-dependent protein kinase type 1G OS=Homo sapiens GN=CAMK1G PE=1 SV=3 243 534 3.0E-31
sp|Q9QYK9|KCC1B_MOUSE Calcium/calmodulin-dependent protein kinase type 1B OS=Mus musculus GN=Pnck PE=1 SV=1 250 519 4.0E-31
sp|Q91VB2|KCC1G_MOUSE Calcium/calmodulin-dependent protein kinase type 1G OS=Mus musculus GN=Camk1g PE=1 SV=1 243 518 4.0E-31
sp|Q7TNJ7|KCC1G_RAT Calcium/calmodulin-dependent protein kinase type 1G OS=Rattus norvegicus GN=Camk1g PE=2 SV=1 243 518 4.0E-31
sp|Q6P2M8|KCC1B_HUMAN Calcium/calmodulin-dependent protein kinase type 1B OS=Homo sapiens GN=PNCK PE=2 SV=2 250 519 5.0E-31
sp|Q03141|MARK3_MOUSE MAP/microtubule affinity-regulating kinase 3 OS=Mus musculus GN=Mark3 PE=1 SV=2 247 518 5.0E-31
sp|Q8CIP4|MARK4_MOUSE MAP/microtubule affinity-regulating kinase 4 OS=Mus musculus GN=Mark4 PE=1 SV=1 243 518 6.0E-31
sp|Q96L34|MARK4_HUMAN MAP/microtubule affinity-regulating kinase 4 OS=Homo sapiens GN=MARK4 PE=1 SV=1 243 518 6.0E-31
sp|Q8BZN4|NUAK2_MOUSE NUAK family SNF1-like kinase 2 OS=Mus musculus GN=Nuak2 PE=1 SV=2 205 534 9.0E-31
sp|O74426|PPK33_SCHPO Serine/threonine-protein kinase ppk33 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk33 PE=3 SV=1 242 534 1.0E-30
sp|Q9VWQ2|S6KL_DROME Serine/threonine-protein kinase S6KL OS=Drosophila melanogaster GN=S6KL PE=1 SV=1 249 470 2.0E-30
sp|Q9Y1J3|PDPK1_CAEEL 3-phosphoinositide-dependent protein kinase 1 OS=Caenorhabditis elegans GN=pdk-1 PE=1 SV=1 244 550 2.0E-30
sp|Q6PHR2|ULK3_HUMAN Serine/threonine-protein kinase ULK3 OS=Homo sapiens GN=ULK3 PE=1 SV=2 240 545 2.0E-30
sp|Q9N2L7|PLK2_CAEEL Serine/threonine-protein kinase plk-2 OS=Caenorhabditis elegans GN=plk-2 PE=2 SV=1 242 527 2.0E-30
sp|Q8MYQ1|Y31E_CAEEL Putative serine/threonine-protein kinase F31E3.2 OS=Caenorhabditis elegans GN=F31E3.2 PE=3 SV=1 239 540 2.0E-30
sp|Q6DBX4|GWL_DANRE Serine/threonine-protein kinase greatwall OS=Danio rerio GN=mastl PE=2 SV=1 228 392 2.0E-30
sp|Q4KTY1|KPSH1_PINFU Serine/threonine-protein kinase H1 homolog OS=Pinctada fucata GN=PSKH1 PE=2 SV=1 242 521 3.0E-30
sp|Q8TFG6|PPK18_SCHPO Serine/threonine-protein kinase ppk18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk18 PE=3 SV=2 244 392 4.0E-30
sp|Q9LP51|CIPKI_ARATH CBL-interacting serine/threonine-protein kinase 18 OS=Arabidopsis thaliana GN=CIPK18 PE=1 SV=1 230 510 4.0E-30
sp|Q6ZLP5|CIPKN_ORYSJ CBL-interacting protein kinase 23 OS=Oryza sativa subsp. japonica GN=CIPK23 PE=2 SV=1 248 511 4.0E-30
sp|Q54C18|Y9452_DICDI Probable serine/threonine-protein kinase DDB_G0293276 OS=Dictyostelium discoideum GN=DDB_G0293276 PE=3 SV=1 244 552 5.0E-30
sp|Q1ZXI5|Y1558_DICDI Probable serine/threonine-protein kinase DDB_G0278845 OS=Dictyostelium discoideum GN=DDB_G0278845 PE=3 SV=1 244 393 5.0E-30
sp|Q9LWM4|CIPK5_ORYSJ CBL-interacting protein kinase 5 OS=Oryza sativa subsp. japonica GN=CIPK5 PE=2 SV=1 248 535 6.0E-30
sp|Q3U3Q1|ULK3_MOUSE Serine/threonine-protein kinase ULK3 OS=Mus musculus GN=Ulk3 PE=2 SV=1 250 545 9.0E-30
sp|Q54TW2|PDPKA_DICDI Probable serine/threonine-protein kinase pdkA OS=Dictyostelium discoideum GN=pdkA PE=3 SV=1 248 388 1.0E-29
sp|Q2QAV0|TIO_ARATH Serine/threonine-protein kinase TIO OS=Arabidopsis thaliana GN=TIO PE=1 SV=1 239 538 1.0E-29
sp|Q10KY3|CAMK1_ORYSJ Calcium/calmodulin-dependent serine/threonine-protein kinase 1 OS=Oryza sativa subsp. japonica GN=CAMK1 PE=1 SV=1 271 538 2.0E-29
sp|P52304|POLO_DROME Serine/threonine-protein kinase polo OS=Drosophila melanogaster GN=polo PE=1 SV=2 229 497 2.0E-29
sp|Q7X996|CIPK2_ORYSJ CBL-interacting protein kinase 2 OS=Oryza sativa subsp. japonica GN=CIPK2 PE=2 SV=1 248 535 2.0E-29
sp|P34101|FHKC_DICDI Probable serine/threonine-protein kinase fhkC OS=Dictyostelium discoideum GN=fhkC PE=3 SV=2 240 534 2.0E-29
sp|Q8VHJ5|MARK1_MOUSE Serine/threonine-protein kinase MARK1 OS=Mus musculus GN=Mark1 PE=1 SV=2 248 490 2.0E-29
sp|D3ZHP7|ULK3_RAT Serine/threonine-protein kinase ULK3 OS=Rattus norvegicus GN=Ulk3 PE=1 SV=1 250 545 3.0E-29
sp|P92937|CIPKF_ARATH CBL-interacting serine/threonine-protein kinase 15 OS=Arabidopsis thaliana GN=CIPK15 PE=1 SV=2 248 507 3.0E-29
sp|O08678|MARK1_RAT Serine/threonine-protein kinase MARK1 OS=Rattus norvegicus GN=Mark1 PE=1 SV=1 248 490 4.0E-29
sp|O60285|NUAK1_HUMAN NUAK family SNF1-like kinase 1 OS=Homo sapiens GN=NUAK1 PE=1 SV=1 177 534 4.0E-29
sp|E1C2I2|GWL_CHICK Serine/threonine-protein kinase greatwall OS=Gallus gallus GN=MASTL PE=3 SV=1 244 392 4.0E-29
sp|Q9ZUZ2|CAMK3_ARATH CDPK-related kinase 3 OS=Arabidopsis thaliana GN=CRK3 PE=1 SV=1 248 535 5.0E-29
sp|Q9SMQ4|SRK2F_ARATH Serine/threonine-protein kinase SRK2F OS=Arabidopsis thaliana GN=SRK2F PE=1 SV=1 244 534 6.0E-29
sp|E1BFR5|GWL_BOVIN Serine/threonine-protein kinase greatwall OS=Bos taurus GN=MASTL PE=3 SV=1 244 392 6.0E-29
sp|Q641K5|NUAK1_MOUSE NUAK family SNF1-like kinase 1 OS=Mus musculus GN=Nuak1 PE=1 SV=1 250 531 6.0E-29
sp|O44997|DAPK_CAEEL Death-associated protein kinase dapk-1 OS=Caenorhabditis elegans GN=dapk-1 PE=2 SV=2 250 535 6.0E-29
sp|Q5ZJH6|ULK3_CHICK Serine/threonine-protein kinase ULK3 OS=Gallus gallus GN=ULK3 PE=2 SV=1 250 533 7.0E-29
sp|Q8C078|KKCC2_MOUSE Calcium/calmodulin-dependent protein kinase kinase 2 OS=Mus musculus GN=Camkk2 PE=1 SV=2 250 534 7.0E-29
sp|O88831|KKCC2_RAT Calcium/calmodulin-dependent protein kinase kinase 2 OS=Rattus norvegicus GN=Camkk2 PE=1 SV=1 250 534 7.0E-29
sp|Q9P0L2|MARK1_HUMAN Serine/threonine-protein kinase MARK1 OS=Homo sapiens GN=MARK1 PE=1 SV=2 248 490 8.0E-29
sp|Q9XIW0|CIPK7_ARATH CBL-interacting serine/threonine-protein kinase 7 OS=Arabidopsis thaliana GN=CIPK7 PE=1 SV=1 250 511 9.0E-29
sp|Q9TXJ0|CMK1_CAEEL Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis elegans GN=cmk-1 PE=1 SV=1 244 534 9.0E-29
sp|Q9STV4|CIPK8_ARATH CBL-interacting serine/threonine-protein kinase 8 OS=Arabidopsis thaliana GN=CIPK8 PE=1 SV=1 248 627 1.0E-28
sp|U4PR86|MELK_CAEEL Maternal embryonic leucine zipper kinase OS=Caenorhabditis elegans GN=pig-1 PE=1 SV=1 250 542 1.0E-28
sp|Q9NRP7|STK36_HUMAN Serine/threonine-protein kinase 36 OS=Homo sapiens GN=STK36 PE=1 SV=2 244 534 1.0E-28
sp|D2HXI8|GWL_AILME Serine/threonine-protein kinase greatwall OS=Ailuropoda melanoleuca GN=MASTL PE=3 SV=1 244 392 1.0E-28
sp|Q96GX5|GWL_HUMAN Serine/threonine-protein kinase greatwall OS=Homo sapiens GN=MASTL PE=1 SV=1 244 392 1.0E-28
sp|Q0JI49|CIPKB_ORYSJ CBL-interacting protein kinase 11 OS=Oryza sativa subsp. japonica GN=CIPK11 PE=2 SV=1 231 519 1.0E-28
sp|Q940H6|SRK2E_ARATH Serine/threonine-protein kinase SRK2E OS=Arabidopsis thaliana GN=SRK2E PE=1 SV=1 244 534 1.0E-28
sp|Q96RR4|KKCC2_HUMAN Calcium/calmodulin-dependent protein kinase kinase 2 OS=Homo sapiens GN=CAMKK2 PE=1 SV=2 250 534 2.0E-28
sp|A8X6H4|CMK1_CAEBR Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis briggsae GN=cmk-1 PE=3 SV=3 244 534 2.0E-28
sp|E2RJI4|GWL_CANLF Serine/threonine-protein kinase greatwall OS=Canis lupus familiaris GN=MASTL PE=3 SV=1 244 392 2.0E-28
sp|Q1XHL7|GRK7B_DANRE G protein-coupled receptor kinase 7B OS=Danio rerio GN=grk7b PE=1 SV=2 244 585 2.0E-28
sp|Q94C95|ATG1A_ARATH Serine/threonine-protein kinase ATG1a OS=Arabidopsis thaliana GN=ATG1A PE=1 SV=1 250 509 2.0E-28
sp|Q5R4K3|KS6A5_PONAB Ribosomal protein S6 kinase alpha-5 OS=Pongo abelii GN=RPS6KA5 PE=2 SV=1 246 519 4.0E-24
sp|O75582|KS6A5_HUMAN Ribosomal protein S6 kinase alpha-5 OS=Homo sapiens GN=RPS6KA5 PE=1 SV=1 246 519 4.0E-24
sp|Q96GX5|GWL_HUMAN Serine/threonine-protein kinase greatwall OS=Homo sapiens GN=MASTL PE=1 SV=1 431 578 5.0E-24
sp|E1BFR5|GWL_BOVIN Serine/threonine-protein kinase greatwall OS=Bos taurus GN=MASTL PE=3 SV=1 431 578 1.0E-23
sp|E2RJI4|GWL_CANLF Serine/threonine-protein kinase greatwall OS=Canis lupus familiaris GN=MASTL PE=3 SV=1 431 578 1.0E-23
sp|Q552E9|PKGA_DICDI Probable serine/threonine-protein kinase pkgA OS=Dictyostelium discoideum GN=pkgA PE=3 SV=1 427 571 1.0E-22
sp|B1WAR9|GWL_XENTR Serine/threonine-protein kinase greatwall OS=Xenopus tropicalis GN=mastl PE=2 SV=1 431 578 2.0E-22
sp|Q6DBX4|GWL_DANRE Serine/threonine-protein kinase greatwall OS=Danio rerio GN=mastl PE=2 SV=1 431 578 2.0E-22
sp|D2HXI8|GWL_AILME Serine/threonine-protein kinase greatwall OS=Ailuropoda melanoleuca GN=MASTL PE=3 SV=1 431 578 5.0E-22
sp|Q5F3L1|KS6A5_CHICK Ribosomal protein S6 kinase alpha-5 OS=Gallus gallus GN=RPS6KA5 PE=2 SV=1 246 519 2.0E-21
sp|E1C2I2|GWL_CHICK Serine/threonine-protein kinase greatwall OS=Gallus gallus GN=MASTL PE=3 SV=1 431 578 4.0E-21
sp|Q6NTJ3|GWL_XENLA Serine/threonine-protein kinase greatwall OS=Xenopus laevis GN=mastl PE=1 SV=1 431 578 7.0E-21
sp|Q8TFG6|PPK18_SCHPO Serine/threonine-protein kinase ppk18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk18 PE=3 SV=2 431 562 2.0E-20
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 250 534 1.0E-19
sp|P18653|KS6A1_MOUSE Ribosomal protein S6 kinase alpha-1 OS=Mus musculus GN=Rps6ka1 PE=1 SV=1 250 534 1.0E-19
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 250 471 2.0E-19
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 250 533 2.0E-19
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 218 522 6.0E-19
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 250 534 8.0E-19
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 250 471 2.0E-18
sp|Q7TPS0|KS6A6_MOUSE Ribosomal protein S6 kinase alpha-6 OS=Mus musculus GN=Rps6ka6 PE=1 SV=2 279 471 2.0E-18
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 250 550 5.0E-18
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 250 550 6.0E-18
sp|Q8C050|KS6A5_MOUSE Ribosomal protein S6 kinase alpha-5 OS=Mus musculus GN=Rps6ka5 PE=1 SV=2 316 519 1.0E-17
sp|Q54TW2|PDPKA_DICDI Probable serine/threonine-protein kinase pdkA OS=Dictyostelium discoideum GN=pdkA PE=3 SV=1 427 545 2.0E-17
sp|Q9UK32|KS6A6_HUMAN Ribosomal protein S6 kinase alpha-6 OS=Homo sapiens GN=RPS6KA6 PE=1 SV=1 292 471 4.0E-17
sp|Q6PFQ0|KS6A6_DANRE Ribosomal protein S6 kinase alpha-6 OS=Danio rerio GN=rps6ka6 PE=2 SV=1 252 471 1.0E-16
sp|P10666|KS6AB_XENLA Ribosomal protein S6 kinase 2 beta OS=Xenopus laevis PE=2 SV=1 250 471 1.0E-16
sp|Q9Z2B9|KS6A4_MOUSE Ribosomal protein S6 kinase alpha-4 OS=Mus musculus GN=Rps6ka4 PE=1 SV=2 250 519 8.0E-16
sp|Q18846|KS6A2_CAEEL Putative ribosomal protein S6 kinase alpha-2 OS=Caenorhabditis elegans GN=rskn-2 PE=3 SV=2 249 551 1.0E-15
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 250 522 1.0E-14
sp|O75676|KS6A4_HUMAN Ribosomal protein S6 kinase alpha-4 OS=Homo sapiens GN=RPS6KA4 PE=1 SV=1 250 519 1.0E-14
sp|Q1ZXI5|Y1558_DICDI Probable serine/threonine-protein kinase DDB_G0278845 OS=Dictyostelium discoideum GN=DDB_G0278845 PE=3 SV=1 430 567 1.0E-14
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0044238 primary metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0006793 phosphorus metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0044267 cellular protein metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0016301 kinase activity No
GO:0044260 cellular macromolecule metabolic process No
GO:0008144 drug binding No
GO:0036211 protein modification process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0003824 catalytic activity No
GO:0016310 phosphorylation No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006464 cellular protein modification process No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0043170 macromolecule metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0019538 protein metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0006796 phosphate-containing compound metabolic process No
GO:0043412 macromolecule modification No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 62 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5128
MNSAAGNAADKDKDRDKDKHASSSSSTANNSNAAPSAGATAAAAAGSDTSGSKPSRHTKFFSNAVGRLRAHTVAS
EGNQVEEALSPTAHANPYFAHQGQPGLRHHNDGSVPPSPPDTPTLKISGPDTAPPDQATSETKEELARRLRRVAS
APNAQGLFAKDEANCDRPATAELGKDPLAEDAESGSLGFAGTRAEAAKNQSLGPPADDGLLAALPPPNTAMAFRR
TYSSNSIKVRNVEVGPSSFDKIKLIGKGDVGKVYLVREKKSSRLYAMKVLSKKEMIKRNKIKRALAEQEILATSN
HPFIVTLYHSFQSDEHLYLCMEYCSGGEFFRALQTRPGKCIPEDDARFYAAEVTAALEYLHLMGFIYRDLKPENI
LLHQSGHIMLSDFDLSKQSDPGGKPTMIIGKNGARTDALPTIDTRSCIANFRTNSFVGTEEYIAPEVIKGSGHTS
AVDWWTLGILVYEMLYGTTPFKGKNRNATFANILREDIPFPDHAGAPQISNLCKSLIRKLLIKDENRRLGARAGA
SDIKAHPFFRTTQWALIRHMKPPIVPHPGRGIDTVNFRNVKESESVDISGSRLKGVPLDSGLATPGLEVEDPFVD
FNSVTLHHDGDDHGSHQHQHHNHQHTNGQHLRASS*
Coding >Hirsu2|5128
ATGAACAGCGCCGCCGGCAACGCCGCCGACAAGGACAAGGACCGGGACAAGGACAAACACGCCTCCTCCTCCTCC
TCCACCGCCAACAACAGCAACGCCGCTCCTTCCGCCGGCGCGACCGCCGCCGCCGCCGCCGGTAGCGACACGTCC
GGCTCCAAGCCCTCGCGGCACACAAAGTTCTTCAGCAATGCCGTCGGCCGCCTGCGCGCCCACACCGTCGCCAGC
GAGGGCAACCAGGTCGAGGAGGCCCTGAGCCCGACCGCCCACGCCAACCCCTACTTCGCCCACCAGGGCCAGCCC
GGCCTGCGCCACCACAACGACGGCTCCGTGCCCCCGAGCCCCCCCGATACCCCGACGCTCAAGATCTCCGGTCCC
GACACCGCCCCGCCCGACCAGGCCACGAGCGAGACCAAGGAAGAGTTGGCTCGCCGCCTCAGGAGGGTCGCCAGT
GCCCCCAACGCCCAGGGTCTCTTCGCAAAGGACGAGGCCAATTGCGATCGTCCCGCCACCGCCGAGCTCGGCAAG
GACCCCCTCGCCGAGGACGCCGAGTCCGGCTCCCTGGGCTTCGCCGGCACCAGGGCCGAGGCCGCCAAGAACCAG
TCTCTGGGGCCGCCCGCCGACGATGGCCTCCTGGCCGCCCTGCCCCCTCCCAACACCGCCATGGCTTTCCGTAGG
ACGTACAGCTCCAACTCCATCAAGGTCCGCAACGTCGAGGTCGGGCCCTCGAGCTTCGACAAGATTAAGCTCATC
GGCAAGGGCGATGTTGGCAAGGTCTACCTGGTCAGGGAGAAGAAGAGTAGCAGGCTGTACGCCATGAAAGTCTTG
AGCAAGAAGGAGATGATCAAGCGAAACAAGATCAAGCGCGCCCTCGCCGAGCAGGAGATCCTGGCCACGAGCAAC
CATCCGTTCATCGTTACCCTCTACCACTCCTTCCAGTCGGACGAGCATTTGTATCTCTGTATGGAGTATTGCAGC
GGCGGCGAGTTCTTCCGCGCTCTGCAGACGCGGCCCGGCAAGTGCATCCCCGAGGATGACGCCCGCTTCTACGCC
GCCGAGGTGACGGCGGCGCTCGAGTACCTCCACCTGATGGGCTTCATCTACCGCGACCTCAAGCCAGAAAATATC
TTACTTCACCAGTCCGGCCACATCATGCTCTCGGACTTTGACCTGTCCAAGCAGTCGGACCCCGGCGGCAAGCCG
ACCATGATCATCGGCAAGAACGGGGCCAGGACAGACGCGCTGCCGACCATCGACACGCGGTCCTGCATCGCCAAC
TTCCGAACCAACTCCTTCGTCGGCACCGAGGAGTACATCGCCCCCGAGGTCATCAAGGGCAGCGGCCACACCAGC
GCCGTCGACTGGTGGACGCTGGGCATCCTCGTATACGAGATGCTGTACGGCACGACGCCCTTCAAGGGCAAGAAT
AGGAACGCCACGTTCGCCAACATCCTACGCGAGGACATTCCCTTCCCCGACCACGCCGGCGCGCCACAAATATCC
AATCTATGCAAGTCCTTGATTCGGAAACTCTTGATCAAAGACGAGAACCGAAGGCTGGGGGCCAGAGCCGGGGCT
TCCGACATCAAGGCCCATCCGTTTTTCCGAACGACGCAGTGGGCTCTCATCCGGCACATGAAGCCCCCGATCGTT
CCTCATCCCGGCCGCGGGATCGACACGGTTAACTTCCGCAACGTCAAGGAGAGTGAAAGCGTGGACATCAGCGGC
TCGAGGCTCAAGGGGGTGCCGCTGGACAGCGGACTGGCCACCCCCGGCCTCGAGGTGGAGGACCCGTTCGTCGAC
TTCAACAGCGTCACGCTGCACCACGACGGCGACGACCACGGCAGCCACCAGCACCAGCACCACAATCACCAGCAC
ACCAACGGCCAGCACTTGCGCGCTTCATCATAG
Transcript >Hirsu2|5128
ATGAACAGCGCCGCCGGCAACGCCGCCGACAAGGACAAGGACCGGGACAAGGACAAACACGCCTCCTCCTCCTCC
TCCACCGCCAACAACAGCAACGCCGCTCCTTCCGCCGGCGCGACCGCCGCCGCCGCCGCCGGTAGCGACACGTCC
GGCTCCAAGCCCTCGCGGCACACAAAGTTCTTCAGCAATGCCGTCGGCCGCCTGCGCGCCCACACCGTCGCCAGC
GAGGGCAACCAGGTCGAGGAGGCCCTGAGCCCGACCGCCCACGCCAACCCCTACTTCGCCCACCAGGGCCAGCCC
GGCCTGCGCCACCACAACGACGGCTCCGTGCCCCCGAGCCCCCCCGATACCCCGACGCTCAAGATCTCCGGTCCC
GACACCGCCCCGCCCGACCAGGCCACGAGCGAGACCAAGGAAGAGTTGGCTCGCCGCCTCAGGAGGGTCGCCAGT
GCCCCCAACGCCCAGGGTCTCTTCGCAAAGGACGAGGCCAATTGCGATCGTCCCGCCACCGCCGAGCTCGGCAAG
GACCCCCTCGCCGAGGACGCCGAGTCCGGCTCCCTGGGCTTCGCCGGCACCAGGGCCGAGGCCGCCAAGAACCAG
TCTCTGGGGCCGCCCGCCGACGATGGCCTCCTGGCCGCCCTGCCCCCTCCCAACACCGCCATGGCTTTCCGTAGG
ACGTACAGCTCCAACTCCATCAAGGTCCGCAACGTCGAGGTCGGGCCCTCGAGCTTCGACAAGATTAAGCTCATC
GGCAAGGGCGATGTTGGCAAGGTCTACCTGGTCAGGGAGAAGAAGAGTAGCAGGCTGTACGCCATGAAAGTCTTG
AGCAAGAAGGAGATGATCAAGCGAAACAAGATCAAGCGCGCCCTCGCCGAGCAGGAGATCCTGGCCACGAGCAAC
CATCCGTTCATCGTTACCCTCTACCACTCCTTCCAGTCGGACGAGCATTTGTATCTCTGTATGGAGTATTGCAGC
GGCGGCGAGTTCTTCCGCGCTCTGCAGACGCGGCCCGGCAAGTGCATCCCCGAGGATGACGCCCGCTTCTACGCC
GCCGAGGTGACGGCGGCGCTCGAGTACCTCCACCTGATGGGCTTCATCTACCGCGACCTCAAGCCAGAAAATATC
TTACTTCACCAGTCCGGCCACATCATGCTCTCGGACTTTGACCTGTCCAAGCAGTCGGACCCCGGCGGCAAGCCG
ACCATGATCATCGGCAAGAACGGGGCCAGGACAGACGCGCTGCCGACCATCGACACGCGGTCCTGCATCGCCAAC
TTCCGAACCAACTCCTTCGTCGGCACCGAGGAGTACATCGCCCCCGAGGTCATCAAGGGCAGCGGCCACACCAGC
GCCGTCGACTGGTGGACGCTGGGCATCCTCGTATACGAGATGCTGTACGGCACGACGCCCTTCAAGGGCAAGAAT
AGGAACGCCACGTTCGCCAACATCCTACGCGAGGACATTCCCTTCCCCGACCACGCCGGCGCGCCACAAATATCC
AATCTATGCAAGTCCTTGATTCGGAAACTCTTGATCAAAGACGAGAACCGAAGGCTGGGGGCCAGAGCCGGGGCT
TCCGACATCAAGGCCCATCCGTTTTTCCGAACGACGCAGTGGGCTCTCATCCGGCACATGAAGCCCCCGATCGTT
CCTCATCCCGGCCGCGGGATCGACACGGTTAACTTCCGCAACGTCAAGGAGAGTGAAAGCGTGGACATCAGCGGC
TCGAGGCTCAAGGGGGTGCCGCTGGACAGCGGACTGGCCACCCCCGGCCTCGAGGTGGAGGACCCGTTCGTCGAC
TTCAACAGCGTCACGCTGCACCACGACGGCGACGACCACGGCAGCCACCAGCACCAGCACCACAATCACCAGCAC
ACCAACGGCCAGCACTTGCGCGCTTCATCATAG
Gene >Hirsu2|5128
ATGAACAGCGCCGCCGGCAACGCCGCCGACAAGGACAAGGACCGGGACAAGGACAAACACGCCTCCTCCTCCTCC
TCCACCGCCAACAACAGCAACGCCGCTCCTTCCGCCGGCGCGACCGCCGCCGCCGCCGCCGGTAGCGACACGTCC
GGCTCCAAGCCCTCGCGGCACACAAAGTTCTTCAGCAATGCCGTCGGCCGCCTGCGCGCCCACACCGTCGCCAGC
GAGGGCAACCAGGTCGAGGAGGCCCTGAGCCCGACCGCCCACGCCAACCCCTACTTCGCCCACCAGGGCCAGCCC
GGCCTGCGCCACCACAACGACGGCTCCGTGCCCCCGAGCCCCCCCGATACCCCGACGCTCAAGATCTCCGGTCCC
GACACCGCCCCGCCCGACCAGGCCACGAGCGAGACCAAGGAAGAGTTGGCTCGCCGCCTCAGGAGGGTCGCCAGT
GCCCCCAACGCCCAGGGTCTCTTCGCAAAGGACGAGGCCAATTGCGATCGTCCCGCCACCGCCGAGCTCGGCAAG
GACCCCCTCGCCGAGGACGCCGAGTCCGGCTCCCTGGGCTTCGCCGGCACCAGGGCCGAGGCCGCCAAGAACCAG
TCTCTGGGGCCGCCCGCCGACGATGGCCTCCTGGCCGCCCTGCCCCCTCCCAACACCGCCATGGCTTTCCGTAGG
ACGTACAGCTCCAACTCCATCAAGGTCCGCAACGTCGAGGTCGGGCCCTCGAGCTTCGACAAGATTAAGCTCATC
GGCAAGGGCGATGTTGGCAAGGTCTACCTGGTCAGGGAGAAGAAGAGTAGCAGGCTGTACGCCATGAAAGGTAGG
CTATTCGTCGCCCGCCCTCGCTTGCCCGACACCCCGGCCCGCCGCCCTCGTCTGACCCGTCGTTCTCGCAGTCTT
GAGCAAGAAGGAGATGATCAAGCGAAACAAGATCAAGCGCGCCCTCGCCGAGCAGGAGATCCTGGCCACGAGCAA
CCATCCGTTCATCGTTACCCTCTACCACTCCTTCCAGTCGGACGAGCATTTGTATCTCTGTATGGAGTATTGCAG
CGGCGGCGAGTTCTTCCGCGCTCTGCAGACGCGGCCCGGCAAGTGCATCCCCGAGGATGACGCCCGCTTCTACGC
CGCCGAGGTGACGGCGGCGCTCGAGTACCTCCACCTGATGGGCTTCATCTACCGCGACCTCAAGCCAGAAAGTCA
GTCCGCCCGCCCGCCCGCGTCGGCTCGGGCCGACGTCGCACCCCGCCGCTGACAAGGCTTCCAGATATCTTACTT
CACCAGTCCGGCCACATCATGCTCTCGGACTTTGACCTGTCCAAGCAGTCGGACCCCGGCGGCAAGCCGACCATG
ATCATCGGCAAGAACGGGGCCAGGACAGACGCGCTGCCGACCATCGACACGCGGTCCTGCATCGCCAACTTCCGA
ACCAACTCCTTCGTCGGCACCGAGGAGTACATCGCCCCCGAGGTCATCAAGGGCAGCGGCCACACCAGCGCCGTC
GACTGGTGGACGCTGGGCATCCTCGTATACGAGATGCTGTACGGCACGACGCCCTTCAAGGGCAAGAATAGGAAC
GCCACGTTCGCCAACATCCTACGCGAGGACATTCCCTTCCCCGACCACGCCGGCGCGCCACAAATATCCAAGTGA
GAGAACCCCCAACCCCTCACCCCCTCGCCGACCTGTGTCGATCTGGCTCGCGACGCACGTGGCGCTGACCCTGTC
TTGCCGCTCCGGACAGTCTATGCAAGTCCTTGATTCGGAAACTCTTGATCAAAGACGAGAACCGAAGGCTGGGGG
CCAGAGCCGGGGCTTCCGACATCAAGGCCCATCCGTTTTTCCGAACGACGCAGTGGGCTCTCATCCGGCACATGA
AGCCCCCGATCGTTCCTCATCCCGGCCGCGGGATCGACACGGTTAACTTCCGCAACGTCAAGGAGAGTGAAAGCG
TGGACATCAGCGGCTCGAGGCTCAAGGGGGTGCCGCTGGACAGCGGACTGGCCACCCCCGGCCTCGAGGTGGAGG
ACCCGTTCGTCGACTTCAACAGCGTCACGCTGCACCACGACGGCGACGACCACGGCAGCCACCAGCACCAGCACC
ACAATCACCAGCACACCAACGGCCAGCACTTGCGCGCTTCATCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail