Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5122
Gene name
LocationContig_2566:323..2333
Strand-
Gene length (bp)2010
Transcript length (bp)1869
Coding sequence length (bp)1869
Protein length (aa) 623

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06011 TRP Transient receptor potential (TRP) ion channel 9.2E-39 206 571
PF14558 TRP_N ML-like domain 7.0E-24 6 189

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O94543|YCD3_SCHPO Uncharacterized membrane protein C1322.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1322.03 PE=3 SV=1 153 615 7.0E-54

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

Domain # Start End Length
1 194 216 22
2 330 352 22
3 378 400 22
4 410 432 22
5 523 545 22
6 550 572 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5122
LAAAAHVDVTNCLPDSYRSVTPARLQWQPLHAEARFDARGGRYNLEFVVWGNVTGASPGQPAPPPAGDAYWSNPN
KTNGKIIETPDPDAENKKATTLYRRVTVLTYEPWNERAYFCRDLVNGSCPLGPVFDDDVDDATFPLGLPSVNMSH
DFFSSYAFSSFAATMLIISGDAKADNIGCVSAIITPDLGGVAWVFRYLPLIILLFSALAVVFAGVFSPWGATNIF
HWTSNYGRDTDLLRLVTPGFGDCLQYIQFVVLTGGLSLSYPGFYQPVVSQAAWSALMFNESLVTRAAPWQSVVDG
IYLTNATDGYGLHQLGQLTGMADSADIWPGMMVWLCVILAGAFCSVQACFLVQWLWRRLNNISEEDLRAKNVPFS
AGNVVRTLFNYMLLPLVALSAFQLVVARASPAYTVALAVLTLVLLMASATWIVALIIRTRPKSVLFDDLPTVLRF
GPLYNTYSDEVAAFALVPVLLNFVRGVAIGAVQPSGVAQVVLLAICEVIQVFTLHAFRPFHPSTSMNAYHTLFSA
LRAVTILLMVAFVPSLGVTEGPKGWIGYAILLVHAAVLILGFFLSALQTMVEVVARMLGAGGDDVSGLRRGGLSK
IFGMRQLSRRETHRPAPTAPAT*
Coding >Hirsu2|5122
CTGGCCGCCGCCGCCCACGTCGACGTCACCAACTGCCTGCCCGACTCGTACCGGTCCGTCACGCCGGCCCGGCTG
CAGTGGCAGCCCTTGCACGCCGAGGCCCGCTTCGACGCCCGCGGCGGCCGCTACAACCTCGAGTTCGTCGTCTGG
GGCAACGTCACCGGCGCCTCCCCCGGCCAGCCCGCCCCGCCGCCCGCCGGCGACGCCTACTGGTCCAACCCGAAC
AAGACCAACGGCAAGATCATCGAGACGCCCGACCCGGACGCCGAGAACAAGAAGGCCACCACGCTCTACCGCAGG
GTCACCGTCCTGACCTACGAGCCGTGGAATGAGCGCGCCTACTTTTGCCGCGACCTCGTCAACGGCTCGTGCCCG
CTGGGGCCCGTCTTCGACGACGACGTCGACGATGCCACCTTCCCCCTCGGCCTCCCCTCCGTCAACATGAGCCAC
GACTTCTTCTCCTCGTACGCCTTCTCCTCCTTCGCCGCCACCATGCTCATCATCTCGGGCGACGCCAAGGCCGAC
AACATCGGCTGCGTCTCCGCCATCATCACCCCGGACCTCGGCGGCGTCGCCTGGGTCTTCCGCTACCTGCCCCTC
ATCATCCTCCTCTTCTCCGCCCTCGCCGTCGTCTTCGCCGGCGTCTTCAGCCCCTGGGGCGCCACCAACATCTTC
CACTGGACCTCCAACTACGGCCGCGACACGGACCTCCTGCGCCTCGTCACCCCCGGCTTCGGCGACTGCCTCCAG
TACATCCAGTTCGTCGTCCTCACCGGCGGCCTCTCCCTCAGCTACCCCGGTTTCTACCAGCCCGTCGTCAGCCAG
GCCGCCTGGTCCGCCCTCATGTTCAACGAGAGCCTCGTCACCCGCGCCGCCCCCTGGCAGAGCGTCGTCGACGGC
ATCTACCTCACCAACGCCACCGACGGCTACGGCCTGCACCAGCTCGGCCAGCTCACCGGCATGGCCGACAGCGCC
GACATCTGGCCCGGCATGATGGTCTGGCTCTGCGTCATCCTCGCCGGCGCCTTCTGCTCCGTCCAGGCCTGCTTC
CTCGTCCAGTGGCTCTGGCGCCGCCTCAACAACATCTCCGAGGAGGACCTCCGCGCCAAGAACGTGCCCTTTAGC
GCCGGCAACGTCGTCCGCACCCTCTTCAACTACATGCTCCTCCCCCTCGTCGCCCTCTCCGCCTTCCAGCTCGTC
GTCGCCCGCGCCTCGCCCGCCTACACCGTCGCCCTCGCCGTCCTGACGCTCGTCCTGCTCATGGCCTCGGCCACC
TGGATCGTCGCCCTCATCATCCGCACCCGCCCCAAGTCGGTCCTCTTCGACGACCTGCCCACCGTCCTCCGCTTC
GGGCCCCTCTACAACACCTACTCGGACGAGGTGGCCGCCTTCGCTCTCGTCCCCGTCCTGCTCAACTTCGTCCGC
GGCGTCGCCATCGGCGCCGTCCAGCCGAGCGGCGTCGCCCAGGTCGTCCTGCTCGCCATCTGCGAGGTCATCCAG
GTCTTCACCCTGCACGCCTTCCGCCCCTTCCACCCCTCCACCTCGATGAACGCCTACCACACCCTCTTCTCCGCC
CTGCGCGCCGTCACCATCCTGCTCATGGTCGCCTTCGTCCCCAGCCTCGGCGTCACCGAGGGGCCCAAGGGCTGG
ATCGGCTACGCCATCCTGCTCGTCCACGCCGCCGTCCTCATCCTCGGCTTCTTCCTCAGCGCCCTGCAGACCATG
GTCGAGGTCGTCGCCCGCATGCTCGGCGCCGGCGGCGACGACGTCTCCGGCCTGAGGCGCGGCGGCCTCTCCAAG
ATCTTCGGCATGCGCCAGCTGTCGCGCCGCGAGACGCACCGCCCGGCCCCGACCGCCCCGGCTACATGA
Transcript >Hirsu2|5122
CTGGCCGCCGCCGCCCACGTCGACGTCACCAACTGCCTGCCCGACTCGTACCGGTCCGTCACGCCGGCCCGGCTG
CAGTGGCAGCCCTTGCACGCCGAGGCCCGCTTCGACGCCCGCGGCGGCCGCTACAACCTCGAGTTCGTCGTCTGG
GGCAACGTCACCGGCGCCTCCCCCGGCCAGCCCGCCCCGCCGCCCGCCGGCGACGCCTACTGGTCCAACCCGAAC
AAGACCAACGGCAAGATCATCGAGACGCCCGACCCGGACGCCGAGAACAAGAAGGCCACCACGCTCTACCGCAGG
GTCACCGTCCTGACCTACGAGCCGTGGAATGAGCGCGCCTACTTTTGCCGCGACCTCGTCAACGGCTCGTGCCCG
CTGGGGCCCGTCTTCGACGACGACGTCGACGATGCCACCTTCCCCCTCGGCCTCCCCTCCGTCAACATGAGCCAC
GACTTCTTCTCCTCGTACGCCTTCTCCTCCTTCGCCGCCACCATGCTCATCATCTCGGGCGACGCCAAGGCCGAC
AACATCGGCTGCGTCTCCGCCATCATCACCCCGGACCTCGGCGGCGTCGCCTGGGTCTTCCGCTACCTGCCCCTC
ATCATCCTCCTCTTCTCCGCCCTCGCCGTCGTCTTCGCCGGCGTCTTCAGCCCCTGGGGCGCCACCAACATCTTC
CACTGGACCTCCAACTACGGCCGCGACACGGACCTCCTGCGCCTCGTCACCCCCGGCTTCGGCGACTGCCTCCAG
TACATCCAGTTCGTCGTCCTCACCGGCGGCCTCTCCCTCAGCTACCCCGGTTTCTACCAGCCCGTCGTCAGCCAG
GCCGCCTGGTCCGCCCTCATGTTCAACGAGAGCCTCGTCACCCGCGCCGCCCCCTGGCAGAGCGTCGTCGACGGC
ATCTACCTCACCAACGCCACCGACGGCTACGGCCTGCACCAGCTCGGCCAGCTCACCGGCATGGCCGACAGCGCC
GACATCTGGCCCGGCATGATGGTCTGGCTCTGCGTCATCCTCGCCGGCGCCTTCTGCTCCGTCCAGGCCTGCTTC
CTCGTCCAGTGGCTCTGGCGCCGCCTCAACAACATCTCCGAGGAGGACCTCCGCGCCAAGAACGTGCCCTTTAGC
GCCGGCAACGTCGTCCGCACCCTCTTCAACTACATGCTCCTCCCCCTCGTCGCCCTCTCCGCCTTCCAGCTCGTC
GTCGCCCGCGCCTCGCCCGCCTACACCGTCGCCCTCGCCGTCCTGACGCTCGTCCTGCTCATGGCCTCGGCCACC
TGGATCGTCGCCCTCATCATCCGCACCCGCCCCAAGTCGGTCCTCTTCGACGACCTGCCCACCGTCCTCCGCTTC
GGGCCCCTCTACAACACCTACTCGGACGAGGTGGCCGCCTTCGCTCTCGTCCCCGTCCTGCTCAACTTCGTCCGC
GGCGTCGCCATCGGCGCCGTCCAGCCGAGCGGCGTCGCCCAGGTCGTCCTGCTCGCCATCTGCGAGGTCATCCAG
GTCTTCACCCTGCACGCCTTCCGCCCCTTCCACCCCTCCACCTCGATGAACGCCTACCACACCCTCTTCTCCGCC
CTGCGCGCCGTCACCATCCTGCTCATGGTCGCCTTCGTCCCCAGCCTCGGCGTCACCGAGGGGCCCAAGGGCTGG
ATCGGCTACGCCATCCTGCTCGTCCACGCCGCCGTCCTCATCCTCGGCTTCTTCCTCAGCGCCCTGCAGACCATG
GTCGAGGTCGTCGCCCGCATGCTCGGCGCCGGCGGCGACGACGTCTCCGGCCTGAGGCGCGGCGGCCTCTCCAAG
ATCTTCGGCATGCGCCAGCTGTCGCGCCGCGAGACGCACCGCCCGGCCCCGACCGCCCCGGCTACATGA
Gene >Hirsu2|5122
CTGGCCGCCGCCGCCCACGTCGACGTCACCAACTGCCTGCCCGACTCGTACCGGTCCGTCACGCCGGCCCGGCTG
CAGTGGCAGCCCTTGCACGCCGAGGCCCGCTTCGACGCCCGCGGCGGCCGCTACAACCTCGAGTTCGTCGTCTGG
GGCAACGTCACCGGCGCCTCCCCCGGCCAGCCCGCCCCGCCGCCCGCCGGCGACGCCTACTGGTCCAACCCGAAC
AAGACCAACGGCAAGATCATCGAGACGCCCGACCCGGACGCCGAGAACAAGAAGGCCACCACGCTCTACCGCAGG
GTCACCGTCCTGACCTACGAGCCGTGGAATGAGCGCGCCTACTTTTGCCGCGACCTCGTCAACGGCTCGTGCCCG
CTGGGGCCCGTCTTCGACGACGACGTCGACGATGCGTACGTGCTCGGTCCAGATGGCCTCCCCTGATGGACGCTG
GCCCGACCGTGTGCTTCTGATGGACGCTGACCAGAACCTCTCCCCCCCCGTACAGCACCTTCCCCCTCGGCCTCC
CCTCCGTCAACATGAGCCACGACTTCTTCTCCTCGTACGCCTTCTCCTCCTTCGCCGCCACCATGCTCATCATCT
CGGGCGACGCCAAGGCCGACAACATCGGCTGCGTCTCCGCCATCATCACCCCGGACCTCGGCGGCGTCGCCTGGG
TCTTCCGCTACCTGCCCCTCATCATCCTCCTCTTCTCCGCCCTCGCCGTCGTCTTCGCCGGCGTCTTCAGCCCCT
GGGGCGCCACCAACATCTTCCACTGGACCTCCAACTACGGCCGCGACACGGACCTCCTGCGCCTCGTCACCCCCG
GCTTCGGCGACTGCCTCCAGTACATCCAGTTCGTCGTCCTCACCGGCGGCCTCTCCCTCAGCTACCCCGGTTTCT
ACCAGCCCGTCGTCAGCCAGGCCGCCTGGTCCGCCCTCATGTTCAACGAGAGCCTCGTCACCCGCGCCGCCCCCT
GGCAGAGCGTCGTCGACGGCATCTACCTCACCAACGCCACCGACGGCTACGGCCTGCACCAGCTCGGCCAGCTCA
CCGGCATGGCCGACAGCGCCGACATCTGGCCCGGCATGATGGTCTGGCTCTGCGTCATCCTCGCCGGCGCCTTCT
GCTCCGTCCAGGCCTGCTTCCTCGTCCAGTGGCTCTGGCGCCGCCTCAACAACATCTCCGAGGAGGACCTCCGCG
CCAAGAACGTGCCCTTTAGCGCCGGCAACGTCGTCCGCACCCTCTTCAACTACATGCTCCTCCCCCTCGTCGCCC
TCTCCGCCTTCCAGCTCGTCGTCGCCCGCGCCTCGCCCGCCTACACCGTCGCCCTCGCCGTCCTGACGCTCGTCC
TGCTCATGGCCTCGGCCACCTGGATCGTCGCCCTCATCATCCGCACCCGCCCCAAGTCGGTCCTCTTCGACGACC
TGCCCACCGTCCTCCGCTTCGGGCCCCTCTACAACACCTACTCGGACGAGGTGGCCGCCTTCGCTCTCGTCCCCG
TCCTGCTCAACTTCGTCCGCGGCGTCGCCATCGGCGCCGTCCAGCCGAGCGGCGTCGCCCAGGTCGTCCTGCTCG
CCATCTGCGAGGTCATCCAGGTCTTCACCCTGCACGCCTTCCGCCCCTTCCACCCCTCCACCTCGATGAACGCCT
ACCACACCCTCTTCTCCGCCCTGCGCGCCGTCACCATCCTGCTCATGGTCGCCTTCGTCCCCAGCCTCGGCGTCA
CCGAGGGGCCCAAGGGCTGGATCGGCTACGCCATCCTGCTCGTCCACGCCGCCGTCCTCATCCTCGGCTTCTTCC
TCAGCGCCCTGCAGACCATGGTCGAGGTCGTCGCCCGCATGCTCGGCGCCGGCGGCGACGACGTCTCCGGCCTGA
GGCGCGGCGGCCTCTCCAAGATCTTCGGCATGCGCCAGCTGTCGCGCCGCGAGACGCACCGCCCGGCCCCGTCGA
GGGCCAGCCAGCTGTCGACGGCCGGCATGCTCGACGTCGAGGACCGCCCCGGCTACATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail