Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5114
Gene name
LocationContig_2560:79..973
Strand-
Gene length (bp)894
Transcript length (bp)894
Coding sequence length (bp)894
Protein length (aa) 298

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00657 Lipase_GDSL GDSL-like Lipase/Acylhydrolase 1.8E-25 28 292
PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family 4.0E-08 30 287

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q99289|HLT_VIBPA Thermolabile hemolysin OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=VPA0226 PE=1 SV=2 6 293 3.0E-20
sp|P10480|GCAT_AERHY Phosphatidylcholine-sterol acyltransferase OS=Aeromonas hydrophila PE=1 SV=3 4 182 4.0E-18
sp|Q9SJB4|GDL34_ARATH GDSL esterase/lipase At2g04570 OS=Arabidopsis thaliana GN=At2g04570 PE=2 SV=1 10 296 1.0E-11
sp|Q9FD10|SSEJ_SALTY Secreted effector protein SseJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=sseJ PE=1 SV=1 26 290 2.0E-11
sp|Q6B6R8|ESTA_PSEPU Esterase EstA OS=Pseudomonas putida GN=estA PE=3 SV=1 7 290 5.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q99289|HLT_VIBPA Thermolabile hemolysin OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=VPA0226 PE=1 SV=2 6 293 3.0E-20
sp|P10480|GCAT_AERHY Phosphatidylcholine-sterol acyltransferase OS=Aeromonas hydrophila PE=1 SV=3 4 182 4.0E-18
sp|Q9SJB4|GDL34_ARATH GDSL esterase/lipase At2g04570 OS=Arabidopsis thaliana GN=At2g04570 PE=2 SV=1 10 296 1.0E-11
sp|Q9FD10|SSEJ_SALTY Secreted effector protein SseJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=sseJ PE=1 SV=1 26 290 2.0E-11
sp|Q6B6R8|ESTA_PSEPU Esterase EstA OS=Pseudomonas putida GN=estA PE=3 SV=1 7 290 5.0E-11
sp|O33407|ESTA_PSEAE Esterase EstA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=estA PE=1 SV=1 7 290 5.0E-11
sp|Q9FJ41|GDL85_ARATH GDSL esterase/lipase At5g45950 OS=Arabidopsis thaliana GN=At5g45950 PE=2 SV=1 12 291 1.0E-10
sp|Q9LMJ3|GDL1_ARATH GDSL esterase/lipase At1g06990 OS=Arabidopsis thaliana GN=At1g06990 PE=2 SV=2 23 297 2.0E-10
sp|Q8VY93|GDL66_ARATH GDSL esterase/lipase At4g26790 OS=Arabidopsis thaliana GN=At4g26790 PE=2 SV=1 18 295 8.0E-10
sp|Q9C7N4|GDL15_ARATH GDSL esterase/lipase At1g29670 OS=Arabidopsis thaliana GN=At1g29670 PE=2 SV=1 1 291 2.0E-09
sp|Q8L5Z1|GDL17_ARATH GDSL esterase/lipase At1g33811 OS=Arabidopsis thaliana GN=At1g33811 PE=2 SV=1 1 292 2.0E-09
sp|Q9C7N5|GDL14_ARATH GDSL esterase/lipase At1g29660 OS=Arabidopsis thaliana GN=At1g29660 PE=2 SV=1 1 291 2.0E-08
sp|Q9SF78|GDL29_ARATH GDSL esterase/lipase At1g71691 OS=Arabidopsis thaliana GN=At1g71691 PE=2 SV=1 27 291 2.0E-08
sp|Q0WUV7|EXL4_ARATH GDSL esterase/lipase EXL4 OS=Arabidopsis thaliana GN=EXL4 PE=1 SV=1 25 293 9.0E-08
sp|O80470|GDL38_ARATH GDSL esterase/lipase At2g23540 OS=Arabidopsis thaliana GN=At2g23540 PE=2 SV=1 30 293 4.0E-07
sp|Q9M8Y5|LTL1_ARATH GDSL esterase/lipase LTL1 OS=Arabidopsis thaliana GN=LTL1 PE=2 SV=1 4 293 9.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016788 hydrolase activity, acting on ester bonds Yes
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5114
MLALGFVASLLLSASHAVPCGPAKYSSVVVFGDSYSDNGNGFAMTNQTWPADPAYYKGRFSNGPVWPEYLAASLG
IPLHDHAHGGATTSNALVRGYTGRKGNQLVPSLEDQVDKYLSTERDEATPVDSALFILWGGVNDALANQSITPAQ
SANVLSSLVTKLQDAGAAHFLLLGFPDLSMIPWDSLIDGASREMLHDYSVGLGEQLGRLAERVSMSSEARANYIS
LAPLFHSFGFYKEGWKAAGFDQFGLYGSCLVGAYTKAPRTLCADPEKRVYWDEFHPSRKAHELIAKTIRKTL*
Coding >Hirsu2|5114
ATGCTTGCCCTCGGCTTCGTCGCGTCACTGCTGCTGTCCGCCAGCCATGCGGTCCCGTGCGGGCCGGCCAAGTAC
TCGTCCGTCGTCGTGTTCGGAGATTCATACTCGGACAATGGCAACGGCTTCGCGATGACGAACCAGACCTGGCCC
GCCGACCCGGCCTACTACAAAGGCCGCTTCAGCAACGGTCCCGTCTGGCCCGAGTACCTGGCCGCCAGCCTCGGC
ATCCCCCTGCACGACCACGCCCACGGCGGAGCGACGACGTCCAACGCCCTGGTCCGCGGCTACACCGGCCGCAAG
GGCAACCAGCTTGTACCCTCGCTCGAGGACCAGGTCGACAAGTACCTCTCGACGGAGCGGGACGAGGCCACGCCC
GTCGACAGTGCTCTGTTCATTCTCTGGGGCGGCGTCAACGACGCGCTGGCCAACCAGAGCATCACGCCCGCACAG
TCGGCCAACGTGCTCTCCAGCCTGGTCACCAAGCTGCAGGACGCCGGCGCCGCGCACTTCCTGCTCCTCGGCTTC
CCCGACCTGTCCATGATTCCGTGGGACAGCCTGATCGATGGCGCGTCGCGCGAGATGCTGCACGACTACTCCGTC
GGCCTGGGCGAACAGCTCGGCCGGCTCGCCGAGCGCGTCAGCATGTCGTCCGAGGCCAGGGCCAACTACATCAGC
CTGGCCCCGCTGTTCCACAGCTTCGGCTTCTACAAGGAGGGCTGGAAGGCCGCCGGCTTCGACCAGTTCGGCCTG
TACGGCAGCTGCCTCGTCGGCGCCTACACCAAGGCGCCGCGGACGCTATGCGCCGATCCTGAGAAGCGTGTCTAC
TGGGATGAGTTTCATCCTTCGCGGAAAGCCCACGAGTTAATTGCGAAGACGATCCGCAAGACCCTGTAG
Transcript >Hirsu2|5114
ATGCTTGCCCTCGGCTTCGTCGCGTCACTGCTGCTGTCCGCCAGCCATGCGGTCCCGTGCGGGCCGGCCAAGTAC
TCGTCCGTCGTCGTGTTCGGAGATTCATACTCGGACAATGGCAACGGCTTCGCGATGACGAACCAGACCTGGCCC
GCCGACCCGGCCTACTACAAAGGCCGCTTCAGCAACGGTCCCGTCTGGCCCGAGTACCTGGCCGCCAGCCTCGGC
ATCCCCCTGCACGACCACGCCCACGGCGGAGCGACGACGTCCAACGCCCTGGTCCGCGGCTACACCGGCCGCAAG
GGCAACCAGCTTGTACCCTCGCTCGAGGACCAGGTCGACAAGTACCTCTCGACGGAGCGGGACGAGGCCACGCCC
GTCGACAGTGCTCTGTTCATTCTCTGGGGCGGCGTCAACGACGCGCTGGCCAACCAGAGCATCACGCCCGCACAG
TCGGCCAACGTGCTCTCCAGCCTGGTCACCAAGCTGCAGGACGCCGGCGCCGCGCACTTCCTGCTCCTCGGCTTC
CCCGACCTGTCCATGATTCCGTGGGACAGCCTGATCGATGGCGCGTCGCGCGAGATGCTGCACGACTACTCCGTC
GGCCTGGGCGAACAGCTCGGCCGGCTCGCCGAGCGCGTCAGCATGTCGTCCGAGGCCAGGGCCAACTACATCAGC
CTGGCCCCGCTGTTCCACAGCTTCGGCTTCTACAAGGAGGGCTGGAAGGCCGCCGGCTTCGACCAGTTCGGCCTG
TACGGCAGCTGCCTCGTCGGCGCCTACACCAAGGCGCCGCGGACGCTATGCGCCGATCCTGAGAAGCGTGTCTAC
TGGGATGAGTTTCATCCTTCGCGGAAAGCCCACGAGTTAATTGCGAAGACGATCCGCAAGACCCTGTAG
Gene >Hirsu2|5114
ATGCTTGCCCTCGGCTTCGTCGCGTCACTGCTGCTGTCCGCCAGCCATGCGGTCCCGTGCGGGCCGGCCAAGTAC
TCGTCCGTCGTCGTGTTCGGAGATTCATACTCGGACAATGGCAACGGCTTCGCGATGACGAACCAGACCTGGCCC
GCCGACCCGGCCTACTACAAAGGCCGCTTCAGCAACGGTCCCGTCTGGCCCGAGTACCTGGCCGCCAGCCTCGGC
ATCCCCCTGCACGACCACGCCCACGGCGGAGCGACGACGTCCAACGCCCTGGTCCGCGGCTACACCGGCCGCAAG
GGCAACCAGCTTGTACCCTCGCTCGAGGACCAGGTCGACAAGTACCTCTCGACGGAGCGGGACGAGGCCACGCCC
GTCGACAGTGCTCTGTTCATTCTCTGGGGCGGCGTCAACGACGCGCTGGCCAACCAGAGCATCACGCCCGCACAG
TCGGCCAACGTGCTCTCCAGCCTGGTCACCAAGCTGCAGGACGCCGGCGCCGCGCACTTCCTGCTCCTCGGCTTC
CCCGACCTGTCCATGATTCCGTGGGACAGCCTGATCGATGGCGCGTCGCGCGAGATGCTGCACGACTACTCCGTC
GGCCTGGGCGAACAGCTCGGCCGGCTCGCCGAGCGCGTCAGCATGTCGTCCGAGGCCAGGGCCAACTACATCAGC
CTGGCCCCGCTGTTCCACAGCTTCGGCTTCTACAAGGAGGGCTGGAAGGCCGCCGGCTTCGACCAGTTCGGCCTG
TACGGCAGCTGCCTCGTCGGCGCCTACACCAAGGCGCCGCGGACGCTATGCGCCGATCCTGAGAAGCGTGTCTAC
TGGGATGAGTTTCATCCTTCGCGGAAAGCCCACGAGTTAATTGCGAAGACGATCCGCAAGACCCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail