Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5111
Gene name
LocationContig_256:20720..21182
Strand-
Gene length (bp)462
Transcript length (bp)393
Coding sequence length (bp)393
Protein length (aa) 131

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02656 DUF202 Domain of unknown function (DUF202) 2.0E-15 24 85

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UR17|VTC1_SCHPO Vacuolar transporter chaperone 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nrf1 PE=2 SV=1 1 120 2.0E-56
sp|P40046|VTC1_YEAST Vacuolar transporter chaperone 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VTC1 PE=1 SV=3 1 128 8.0E-52
sp|P78810|VTC4_SCHPO Vacuolar transporter chaperone 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vtc4 PE=1 SV=2 9 118 2.0E-22
sp|P47075|VTC4_YEAST Vacuolar transporter chaperone 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VTC4 PE=1 SV=2 7 116 5.0E-21
sp|O13718|VTC2_SCHPO Vacuolar transporter chaperone 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vtc2 PE=1 SV=1 14 122 7.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UR17|VTC1_SCHPO Vacuolar transporter chaperone 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nrf1 PE=2 SV=1 1 120 2.0E-56
sp|P40046|VTC1_YEAST Vacuolar transporter chaperone 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VTC1 PE=1 SV=3 1 128 8.0E-52
sp|P78810|VTC4_SCHPO Vacuolar transporter chaperone 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vtc4 PE=1 SV=2 9 118 2.0E-22
sp|P47075|VTC4_YEAST Vacuolar transporter chaperone 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VTC4 PE=1 SV=2 7 116 5.0E-21
sp|O13718|VTC2_SCHPO Vacuolar transporter chaperone 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vtc2 PE=1 SV=1 14 122 7.0E-15
sp|P43585|VTC2_YEAST Vacuolar transporter chaperone 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VTC2 PE=1 SV=1 16 129 2.0E-12
sp|Q02725|VTC3_YEAST Vacuolar transporter chaperone 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VTC3 PE=1 SV=1 16 128 3.0E-12
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.5

Transmembrane Domains

Domain # Start End Length
1 32 54 22
2 57 79 22
3 99 118 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5111
MSSQPLLQTAPGKRIALPTRVEPKVFFANERTFLSWLNFTVILGALAVGMLNFGDRVAFISAFLFTGVAMLTMIY
ALGTYHWRAKSIRMRGQAGFDDRFGPTFLAIILLLAVVVNFVLRITDQSKKQKKG*
Coding >Hirsu2|5111
ATGTCTTCACAGCCTCTTCTGCAAACTGCTCCCGGCAAACGCATCGCCCTGCCGACCAGAGTCGAGCCCAAGGTC
TTCTTCGCCAACGAACGAACCTTTCTATCATGGCTCAACTTCACCGTCATCCTCGGCGCCCTGGCCGTCGGCATG
CTCAACTTCGGCGACCGAGTCGCCTTCATCTCCGCCTTCCTCTTCACCGGCGTGGCCATGCTGACCATGATATAC
GCGCTGGGGACGTACCACTGGAGAGCGAAATCCATTAGAATGAGGGGCCAGGCCGGATTCGACGATCGGTTCGGG
CCCACCTTCTTGGCCATCATTCTTTTGCTGGCCGTCGTCGTCAATTTCGTCCTCCGGATCACGGACCAGTCCAAG
AAGCAGAAGAAGGGCTAG
Transcript >Hirsu2|5111
ATGTCTTCACAGCCTCTTCTGCAAACTGCTCCCGGCAAACGCATCGCCCTGCCGACCAGAGTCGAGCCCAAGGTC
TTCTTCGCCAACGAACGAACCTTTCTATCATGGCTCAACTTCACCGTCATCCTCGGCGCCCTGGCCGTCGGCATG
CTCAACTTCGGCGACCGAGTCGCCTTCATCTCCGCCTTCCTCTTCACCGGCGTGGCCATGCTGACCATGATATAC
GCGCTGGGGACGTACCACTGGAGAGCGAAATCCATTAGAATGAGGGGCCAGGCCGGATTCGACGATCGGTTCGGG
CCCACCTTCTTGGCCATCATTCTTTTGCTGGCCGTCGTCGTCAATTTCGTCCTCCGGATCACGGACCAGTCCAAG
AAGCAGAAGAAGGGCTAG
Gene >Hirsu2|5111
ATGTCTTCACAGCCTCTTCTGCAAACTGCTCCCGGTATGTCAGCCGTCTGCTTCTCCCTTCTCGGCAGCAGGTCG
GCCAAGGAGTAGCTGACAGCCTCTACAGGCAAACGCATCGCCCTGCCGACCAGAGTCGAGCCCAAGGTCTTCTTC
GCCAACGAACGAACCTTTCTATCATGGCTCAACTTCACCGTCATCCTCGGCGCCCTGGCCGTCGGCATGCTCAAC
TTCGGCGACCGAGTCGCCTTCATCTCCGCCTTCCTCTTCACCGGCGTGGCCATGCTGACCATGATATACGCGCTG
GGGACGTACCACTGGAGAGCGAAATCCATTAGAATGAGGGGCCAGGCCGGATTCGACGATCGGTTCGGGCCCACC
TTCTTGGCCATCATTCTTTTGCTGGCCGTCGTCGTCAATTTCGTCCTCCGGATCACGGACCAGTCCAAGAAGCAG
AAGAAGGGCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail