Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5108
Gene name
LocationContig_256:12742..13433
Strand+
Gene length (bp)691
Transcript length (bp)483
Coding sequence length (bp)483
Protein length (aa) 161

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular 0.053 0.0562 0.8838 0.3688 0.0881 0.0017 0.1515 0.109 0.139 0.0067

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.99978

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2986
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1797
Ophiocordyceps australis map64 (Brazil) OphauB2|5259
Ophiocordyceps camponoti-floridani Ophcf2|02109
Ophiocordyceps camponoti-rufipedis Ophun1|1786
Ophiocordyceps kimflemingae Ophio5|3921
Ophiocordyceps subramaniannii Hirsu2|5108 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5108
MKFFLPLTLLVAAGVSAQDKNCQADYIVSHCLASEQGKAQSCPATDYDCLCAAYEAVATCYNNCPNDPRAPDARH
QVANYCQNASLYGTRARANKTTSALASQSTGNALLTTSDAANPTEFLSRTASANARPTSTGAADALSGSTGGVLI
AVAGAVAALL*
Coding >Hirsu2|5108
ATGAAGTTCTTCCTGCCCCTGACTCTCCTCGTCGCCGCCGGCGTCTCGGCCCAGGACAAGAACTGCCAGGCCGAC
TACATCGTGAGCCACTGCCTGGCTAGCGAGCAGGGCAAGGCCCAGAGCTGTCCCGCCACCGACTACGACTGCCTC
TGCGCCGCGTACGAGGCCGTTGCCACCTGCTACAACAACTGCCCCAATGACCCGCGCGCCCCCGACGCCCGCCAC
CAGGTCGCCAACTACTGCCAGAACGCGTCGCTCTACGGCACGCGCGCCCGCGCCAACAAGACGACGTCGGCGCTC
GCCTCACAGTCCACCGGCAACGCGCTGCTGACCACCTCCGACGCCGCCAACCCGACCGAGTTCCTCTCCCGCACC
GCCTCCGCCAACGCCCGGCCCACCAGCACCGGCGCCGCCGACGCCCTCTCCGGCAGCACCGGCGGCGTCCTCATC
GCCGTCGCCGGCGCCGTTGCCGCCCTCCTGTAG
Transcript >Hirsu2|5108
ATGAAGTTCTTCCTGCCCCTGACTCTCCTCGTCGCCGCCGGCGTCTCGGCCCAGGACAAGAACTGCCAGGCCGAC
TACATCGTGAGCCACTGCCTGGCTAGCGAGCAGGGCAAGGCCCAGAGCTGTCCCGCCACCGACTACGACTGCCTC
TGCGCCGCGTACGAGGCCGTTGCCACCTGCTACAACAACTGCCCCAATGACCCGCGCGCCCCCGACGCCCGCCAC
CAGGTCGCCAACTACTGCCAGAACGCGTCGCTCTACGGCACGCGCGCCCGCGCCAACAAGACGACGTCGGCGCTC
GCCTCACAGTCCACCGGCAACGCGCTGCTGACCACCTCCGACGCCGCCAACCCGACCGAGTTCCTCTCCCGCACC
GCCTCCGCCAACGCCCGGCCCACCAGCACCGGCGCCGCCGACGCCCTCTCCGGCAGCACCGGCGGCGTCCTCATC
GCCGTCGCCGGCGCCGTTGCCGCCCTCCTGTAG
Gene >Hirsu2|5108
ATGAAGTTCTTCCTGCCCCTGACTCTCCTCGTCGCCGCCGGCGTCTCGGCCCAGGACAAGAACTGCCAGGCCGAC
TACATCGTGAGCCACTGCCTGGCTAGCGAGCAGGGCAAGGTACGCCCCCTTTCCCTCTGTGCTCCTCTGCCGGCT
TCAATCCCGTCCCGATTCACCGGACTGACCCATCCTTCAGGCCCAGAGCTGTCCCGCCACCGACTACGACTGCCT
CTGCGCCGCGTACGAGGCCGTTGCCACGTAAGTCTAACCCCCCGTCACCACTGTCCCCAGGCGCAGCACAGAAGA
CAGGAGAAGAAAATACGAGGAGAAGAAAATACACCATGTAGAGAAAAAAAAACAGGCATATCCGCTGACTCGAAA
AAAAAAAAGCTGCTACAACAACTGCCCCAATGACCCGCGCGCCCCCGACGCCCGCCACCAGGTCGCCAACTACTG
CCAGAACGCGTCGCTCTACGGCACGCGCGCCCGCGCCAACAAGACGACGTCGGCGCTCGCCTCACAGTCCACCGG
CAACGCGCTGCTGACCACCTCCGACGCCGCCAACCCGACCGAGTTCCTCTCCCGCACCGCCTCCGCCAACGCCCG
GCCCACCAGCACCGGCGCCGCCGACGCCCTCTCCGGCAGCACCGGCGGCGTCCTCATCGCCGTCGCCGGCGCCGT
TGCCGCCCTCCTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail