Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5104
Gene name
LocationContig_256:5438..6507
Strand-
Gene length (bp)1069
Transcript length (bp)975
Coding sequence length (bp)975
Protein length (aa) 325

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10213 MRP-S28 Mitochondrial ribosomal subunit protein 3.3E-42 125 244

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q03976|RT24_YEAST 37S ribosomal protein S24, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSM24 PE=1 SV=1 86 245 3.0E-24
sp|Q09705|RT24_SCHPO 37S ribosomal protein S24, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rsm24 PE=3 SV=1 92 244 6.0E-18

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5104
MAGKTPPGGDASLEVMRQLDELAREGGHPTIDDLFRATLADHKLAAEDRDLSEELIKKDLGPKPNWNSFWYDEED
PEMITEEHDKFDEDDITSMAHGKLDEVREMRHYARLAVWEMPLLSKFAKPFVPPTDDQVLRWRFTTYMGDSHPSE
NKVVVQFAPDDLKLTPVQTEKLKKLAGPRYNPETEFVRMSCESFEHQAQNQQHLLDLVRGLIAAAKDPADTFEDV
PLDLRHHPVKPKPRFPPEWRMTPERHQQLQEQRQAAQLADRQRSDEGLLVDGAKMVQDYQTARAAEEESRQRELE
AKAVEAAKSPPKSDKSDKRLKRKK*
Coding >Hirsu2|5104
ATGGCAGGGAAGACGCCGCCGGGCGGGGACGCCTCCCTGGAAGTGATGCGGCAGCTGGACGAGCTGGCCCGAGAG
GGCGGCCACCCGACAATCGACGACCTCTTCCGAGCGACCCTGGCCGACCACAAGCTGGCGGCCGAGGACAGGGAC
CTGTCGGAGGAGCTGATCAAGAAGGACCTGGGGCCCAAGCCCAACTGGAACTCCTTCTGGTACGACGAGGAGGAT
CCGGAAATGATCACGGAGGAGCACGACAAGTTCGACGAGGACGACATCACGTCCATGGCTCACGGCAAGCTGGAC
GAGGTGCGGGAGATGCGGCACTACGCCCGACTGGCTGTCTGGGAGATGCCACTTTTGTCCAAATTTGCCAAACCG
TTCGTTCCGCCGACCGACGACCAGGTGCTCCGATGGCGCTTCACAACCTACATGGGCGACTCGCACCCGTCCGAG
AACAAGGTGGTGGTGCAGTTTGCGCCCGACGACCTCAAACTCACGCCGGTGCAGACGGAGAAGCTCAAGAAGCTG
GCGGGCCCGCGGTACAACCCGGAGACGGAGTTTGTCAGGATGAGCTGCGAGAGCTTCGAGCACCAGGCGCAGAAC
CAGCAGCACCTGCTGGACCTGGTCAGGGGCCTGATCGCGGCGGCCAAGGACCCGGCGGACACGTTCGAAGACGTG
CCGCTGGACCTGCGGCACCACCCGGTCAAGCCGAAGCCCCGGTTCCCGCCCGAGTGGCGGATGACGCCAGAGCGG
CACCAGCAGCTGCAGGAGCAGCGGCAGGCGGCCCAGCTGGCGGACAGGCAGAGGTCGGACGAGGGGCTGCTGGTG
GACGGGGCCAAGATGGTCCAGGACTACCAGACAGCCAGGGCCGCGGAGGAGGAGTCCAGGCAGCGGGAACTGGAA
GCGAAGGCGGTCGAGGCGGCCAAGTCGCCACCCAAGAGCGACAAGAGCGACAAGAGGCTCAAGCGGAAGAAGTGA
Transcript >Hirsu2|5104
ATGGCAGGGAAGACGCCGCCGGGCGGGGACGCCTCCCTGGAAGTGATGCGGCAGCTGGACGAGCTGGCCCGAGAG
GGCGGCCACCCGACAATCGACGACCTCTTCCGAGCGACCCTGGCCGACCACAAGCTGGCGGCCGAGGACAGGGAC
CTGTCGGAGGAGCTGATCAAGAAGGACCTGGGGCCCAAGCCCAACTGGAACTCCTTCTGGTACGACGAGGAGGAT
CCGGAAATGATCACGGAGGAGCACGACAAGTTCGACGAGGACGACATCACGTCCATGGCTCACGGCAAGCTGGAC
GAGGTGCGGGAGATGCGGCACTACGCCCGACTGGCTGTCTGGGAGATGCCACTTTTGTCCAAATTTGCCAAACCG
TTCGTTCCGCCGACCGACGACCAGGTGCTCCGATGGCGCTTCACAACCTACATGGGCGACTCGCACCCGTCCGAG
AACAAGGTGGTGGTGCAGTTTGCGCCCGACGACCTCAAACTCACGCCGGTGCAGACGGAGAAGCTCAAGAAGCTG
GCGGGCCCGCGGTACAACCCGGAGACGGAGTTTGTCAGGATGAGCTGCGAGAGCTTCGAGCACCAGGCGCAGAAC
CAGCAGCACCTGCTGGACCTGGTCAGGGGCCTGATCGCGGCGGCCAAGGACCCGGCGGACACGTTCGAAGACGTG
CCGCTGGACCTGCGGCACCACCCGGTCAAGCCGAAGCCCCGGTTCCCGCCCGAGTGGCGGATGACGCCAGAGCGG
CACCAGCAGCTGCAGGAGCAGCGGCAGGCGGCCCAGCTGGCGGACAGGCAGAGGTCGGACGAGGGGCTGCTGGTG
GACGGGGCCAAGATGGTCCAGGACTACCAGACAGCCAGGGCCGCGGAGGAGGAGTCCAGGCAGCGGGAACTGGAA
GCGAAGGCGGTCGAGGCGGCCAAGTCGCCACCCAAGAGCGACAAGAGCGACAAGAGGCTCAAGCGGAAGAAGTGA
Gene >Hirsu2|5104
ATGGCAGGGAAGACGCCGCCGGGCGGGGACGCCTCCCTGGAAGTGATGCGGCAGCTGGACGAGCTGGCCCGAGAG
GGCGGCCACCCGACAATCGACGACCTCTTCCGAGCGACCCTGGCCGACCACAAGCTGGCGGCCGAGGACAGGGAC
CTGTCGGAGGAGCTGATCAAGAAGGACCTGGGGCCCAAGCCCAACTGGAACTCCTTCTGGTACGACGAGGAGGAT
CCGGAAATGATCACGGAGGAGCACGACAAGTTCGACGAGGACGACATCACGTCCATGGCTCACGGCAAGCTGGAC
GAGGTGCGGGAGATGCGGCACTACGCCCGACTGGCTGTCTGGGAGATGCCACTTTTGTCCAGTGCGTTTGCTCCC
CCCCCCCCTCTGACATCTGGGCCCCCCCTGGACCACGGGATCGGGACAGGTCGAGGACGACGCAGCTGACGGGGA
ACAAGAATTTGCCAAACCGTTCGTTCCGCCGACCGACGACCAGGTGCTCCGATGGCGCTTCACAACCTACATGGG
CGACTCGCACCCGTCCGAGAACAAGGTGGTGGTGCAGTTTGCGCCCGACGACCTCAAACTCACGCCGGTGCAGAC
GGAGAAGCTCAAGAAGCTGGCGGGCCCGCGGTACAACCCGGAGACGGAGTTTGTCAGGATGAGCTGCGAGAGCTT
CGAGCACCAGGCGCAGAACCAGCAGCACCTGCTGGACCTGGTCAGGGGCCTGATCGCGGCGGCCAAGGACCCGGC
GGACACGTTCGAAGACGTGCCGCTGGACCTGCGGCACCACCCGGTCAAGCCGAAGCCCCGGTTCCCGCCCGAGTG
GCGGATGACGCCAGAGCGGCACCAGCAGCTGCAGGAGCAGCGGCAGGCGGCCCAGCTGGCGGACAGGCAGAGGTC
GGACGAGGGGCTGCTGGTGGACGGGGCCAAGATGGTCCAGGACTACCAGACAGCCAGGGCCGCGGAGGAGGAGTC
CAGGCAGCGGGAACTGGAAGCGAAGGCGGTCGAGGCGGCCAAGTCGCCACCCAAGAGCGACAAGAGCGACAAGAG
GCTCAAGCGGAAGAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail