Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5099
Gene name
LocationContig_2557:71..344
Strand+
Gene length (bp)273
Transcript length (bp)273
Coding sequence length (bp)273
Protein length (aa) 91

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.4769 0.5174 0.2657 0.218 0.2581 0.02 0.104 0.1668 0.2493 0.0244

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup745
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4654
Ophiocordyceps australis map64 (Brazil) OphauB2|950
Ophiocordyceps camponoti-floridani Ophcf2|01544
Ophiocordyceps camponoti-rufipedis Ophun1|7621
Ophiocordyceps kimflemingae Ophio5|4879
Ophiocordyceps subramaniannii Hirsu2|2105
Ophiocordyceps subramaniannii Hirsu2|5099 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5099
LGSGGFPISAFTTLDSAEGFNEATRKIRQAMKDRRKRSDQVRMRTGGGGGGGGGGDDGDDDDDDNNNNNNNGEVD
SEAEQGYSEARKKNM*
Coding >Hirsu2|5099
CTGGGCTCGGGCGGCTTCCCCATCAGCGCCTTCACCACGCTCGACTCGGCCGAGGGCTTCAACGAGGCGACCCGC
AAGATACGGCAGGCGATGAAGGACCGGCGGAAGCGGTCGGACCAGGTCAGGATGCGGACGGGCGGCGGCGGCGGC
GGCGGCGGCGGCGGCGACGACGGCGACGACGACGACGACGACAACAACAACAACAACAACAACGGCGAGGTGGAC
AGCGAGGCCGAGCAGGGATACAGCGAGGCGAGGAAGAAGAACATGTAG
Transcript >Hirsu2|5099
CTGGGCTCGGGCGGCTTCCCCATCAGCGCCTTCACCACGCTCGACTCGGCCGAGGGCTTCAACGAGGCGACCCGC
AAGATACGGCAGGCGATGAAGGACCGGCGGAAGCGGTCGGACCAGGTCAGGATGCGGACGGGCGGCGGCGGCGGC
GGCGGCGGCGGCGGCGACGACGGCGACGACGACGACGACGACAACAACAACAACAACAACAACGGCGAGGTGGAC
AGCGAGGCCGAGCAGGGATACAGCGAGGCGAGGAAGAAGAACATGTAG
Gene >Hirsu2|5099
CTGGGCTCGGGCGGCTTCCCCATCAGCGCCTTCACCACGCTCGACTCGGCCGAGGGCTTCAACGAGGCGACCCGC
AAGATACGGCAGGCGATGAAGGACCGGCGGAAGCGGTCGGACCAGGTCAGGATGCGGACGGGCGGCGGCGGCGGC
GGCGGCGGCGGCGGCGACGACGGCGACGACGACGACGACGACAACAACAACAACAACAACAACGGCGAGGTGGAC
AGCGAGGCCGAGCAGGGATACAGCGAGGCGAGGAAGAAGAACATGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail