Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5096
Gene name
LocationContig_2555:886..1745
Strand-
Gene length (bp)859
Transcript length (bp)513
Coding sequence length (bp)513
Protein length (aa) 171

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02178 AT_hook AT hook motif 5.4E+00 14 21
PF02178 AT_hook AT hook motif 2.3E+00 37 48
PF02178 AT_hook AT hook motif 7.3E-02 93 102
PF02178 AT_hook AT hook motif 1.7E-01 111 121

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 59 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5096
MARTKEDATGESTPRGRGRPSLGSAGDGVKKSYVPTGRPRGRPKSDNPKAKSYVPTGRPRGRPKGSGKKKSAGGG
VAPAATAASSTPKAASGTGKRGRPRKSDAGETPKVKGKRGRPSKKSLEAQDVADAADLDADADAEPLSDHMDDVA
DHAMDQDNLAVESGEESDLD*
Coding >Hirsu2|5096
ATGGCGCGAACCAAGGAAGACGCGACGGGCGAGTCGACGCCCCGCGGCCGCGGCCGGCCCTCGCTGGGCAGCGCC
GGCGACGGCGTCAAGAAGAGCTACGTCCCCACCGGTCGCCCGCGCGGGCGCCCCAAGAGCGACAACCCCAAGGCC
AAGAGCTACGTCCCCACCGGCCGCCCCCGGGGCCGCCCCAAGGGCAGCGGCAAGAAGAAGTCGGCCGGGGGTGGC
GTCGCTCCCGCCGCCACCGCCGCCAGCTCCACGCCCAAGGCCGCCTCGGGCACCGGCAAGCGAGGCCGCCCCCGC
AAGTCGGACGCCGGCGAGACGCCCAAGGTCAAGGGCAAGCGCGGCCGCCCCTCCAAGAAGTCGCTCGAGGCCCAG
GACGTTGCCGATGCCGCCGACCTTGACGCCGACGCCGACGCCGAGCCCCTGTCGGACCACATGGACGACGTAGCC
GATCACGCCATGGACCAGGACAACCTTGCGGTCGAGTCTGGAGAGGAGTCGGATCTCGACTGA
Transcript >Hirsu2|5096
ATGGCGCGAACCAAGGAAGACGCGACGGGCGAGTCGACGCCCCGCGGCCGCGGCCGGCCCTCGCTGGGCAGCGCC
GGCGACGGCGTCAAGAAGAGCTACGTCCCCACCGGTCGCCCGCGCGGGCGCCCCAAGAGCGACAACCCCAAGGCC
AAGAGCTACGTCCCCACCGGCCGCCCCCGGGGCCGCCCCAAGGGCAGCGGCAAGAAGAAGTCGGCCGGGGGTGGC
GTCGCTCCCGCCGCCACCGCCGCCAGCTCCACGCCCAAGGCCGCCTCGGGCACCGGCAAGCGAGGCCGCCCCCGC
AAGTCGGACGCCGGCGAGACGCCCAAGGTCAAGGGCAAGCGCGGCCGCCCCTCCAAGAAGTCGCTCGAGGCCCAG
GACGTTGCCGATGCCGCCGACCTTGACGCCGACGCCGACGCCGAGCCCCTGTCGGACCACATGGACGACGTAGCC
GATCACGCCATGGACCAGGACAACCTTGCGGTCGAGTCTGGAGAGGAGTCGGATCTCGACTGA
Gene >Hirsu2|5096
ATGGCGCGAACCAAGGAAGACGCGACGGGCGAGTCGACGCCCCGCGGCCGCGGCCGGCCCTCGCTGGGCAGCGCC
GGCGACGGCGTCAAGAAGAGCTACGTCCCCACCGGTCGCCCGCGCGGGCGCCCCAAGAGCGACAACCCCAAGGCC
AAGAGCTACGTCCCCACCGGCCGCCCCCGGGGCCGCCCCAAGGGCAGCGGCAAGAAGAAGTCGGCCGGGGGTGGC
GTCGCTCCCGCCGCCACCGCCGCCAGCTCCACGCCCAAGGCCGCCTCGGGCACCGGCAAGCGAGGCCGCCCCCGC
AAGTCGGACGCCGGCGAGACGCCCAAGGTCAAGGGCAAGCGCGGCCGCCCCTCCAAGAAGTCGCTCGAGGCCCAG
GACGTTGCCGATGCCGCCGACCTTGACGCCGACGCCGACGCCGAGCCCCTGTCGGACCACATGGACGGTGAGTCG
GCGTGACCCGGCGTGTGAGCGTGTGCGTGTGCCTGTCGCCTGTCTTGCTCTCGATTCCCACCTCTCCAGCCGTCC
TCTCCCCTCTTCCTTGACCGCTTTGTCTTTTCCTCTCTGTCCGCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNCCCCCCCCCCCCCCCCCAGCATCGTGCGGGCACGTCCATCCATACAC
CTACCCTCTCACAGTTCTCCGTTTTAACCATCCTCTTTCTCCGCAGACGTAGCCGATCACGCCATGGACCAGGAC
AACCTTGCGGTCGAGTCTGGAGAGGTCGGTCAATCACACTCACCATGGGTCTCTGGTCTCAAAAACATGTTTGGC
TGATGCTGGTTGGCAGGAGTCGGATCTCGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail