Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5089
Gene name
LocationContig_255:12764..13769
Strand-
Gene length (bp)1005
Transcript length (bp)1005
Coding sequence length (bp)1005
Protein length (aa) 335

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16499 Melibiase_2 Alpha galactosidase A 3.7E-14 12 108
PF17801 Melibiase_C Alpha galactosidase C-terminal beta sandwich domain 1.2E-11 121 204
PF00652 Ricin_B_lectin Ricin-type beta-trefoil lectin domain 1.9E-09 222 314

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P28351|AGALA_ASPNG Alpha-galactosidase A OS=Aspergillus niger GN=aglA PE=1 SV=1 1 331 8.0E-81
sp|A2QL72|AGALA_ASPNC Probable alpha-galactosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=aglA PE=3 SV=1 1 331 1.0E-79
sp|Q0CPK2|AGALA_ASPTN Probable alpha-galactosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=aglA PE=3 SV=2 1 333 1.0E-75
sp|Q2UT06|AGALA_ASPOR Probable alpha-galactosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=aglA PE=3 SV=1 1 331 1.0E-74
sp|B8MWJ5|AGALA_ASPFN Probable alpha-galactosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=aglA PE=3 SV=1 1 331 1.0E-74
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P28351|AGALA_ASPNG Alpha-galactosidase A OS=Aspergillus niger GN=aglA PE=1 SV=1 1 331 8.0E-81
sp|A2QL72|AGALA_ASPNC Probable alpha-galactosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=aglA PE=3 SV=1 1 331 1.0E-79
sp|Q0CPK2|AGALA_ASPTN Probable alpha-galactosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=aglA PE=3 SV=2 1 333 1.0E-75
sp|Q2UT06|AGALA_ASPOR Probable alpha-galactosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=aglA PE=3 SV=1 1 331 1.0E-74
sp|B8MWJ5|AGALA_ASPFN Probable alpha-galactosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=aglA PE=3 SV=1 1 331 1.0E-74
sp|A1CBW8|AGALA_ASPCL Probable alpha-galactosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=aglA PE=3 SV=1 1 331 4.0E-72
sp|A1DDD8|AGALA_NEOFI Probable alpha-galactosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=aglA PE=3 SV=1 1 331 3.0E-71
sp|Q4WVZ3|AGALA_ASPFU Probable alpha-galactosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=aglA PE=3 SV=1 1 331 3.0E-69
sp|Q8RX86|AGAL2_ARATH Alpha-galactosidase 2 OS=Arabidopsis thaliana GN=AGAL2 PE=1 SV=1 3 161 4.0E-22
sp|Q42656|AGAL_COFAR Alpha-galactosidase OS=Coffea arabica PE=1 SV=1 3 205 1.0E-21
sp|P14749|AGAL_CYATE Alpha-galactosidase OS=Cyamopsis tetragonoloba PE=1 SV=1 3 205 2.0E-20
sp|Q9FXT4|AGAL_ORYSJ Alpha-galactosidase OS=Oryza sativa subsp. japonica GN=Os10g0493600 PE=1 SV=1 3 205 3.0E-20
sp|Q8VXZ7|AGAL3_ARATH Alpha-galactosidase 3 OS=Arabidopsis thaliana GN=AGAL3 PE=1 SV=1 3 205 5.0E-20
sp|Q90744|NAGAB_CHICK Alpha-N-acetylgalactosaminidase OS=Gallus gallus GN=NAGA PE=1 SV=1 9 190 6.0E-19
sp|Q55B10|AGAL_DICDI Probable alpha-galactosidase OS=Dictyostelium discoideum GN=melA PE=3 SV=1 8 205 2.0E-18
sp|B3PGJ1|AGAL_CELJU Alpha-galactosidase A OS=Cellvibrio japonicus (strain Ueda107) GN=agaA PE=1 SV=1 3 205 1.0E-17
sp|Q9FT97|AGAL1_ARATH Alpha-galactosidase 1 OS=Arabidopsis thaliana GN=AGAL1 PE=2 SV=1 3 181 7.0E-17
sp|Q0CVX4|AGALD_ASPTN Probable alpha-galactosidase D OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=aglD PE=3 SV=2 3 220 1.0E-16
sp|A2R2S6|AGALD_ASPNC Probable alpha-galactosidase D OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=aglD PE=3 SV=2 3 181 2.0E-16
sp|B8N7Z0|AGALD_ASPFN Probable alpha-galactosidase D OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=aglD PE=3 SV=1 3 204 8.0E-14
sp|Q5AX28|AGALD_EMENI Alpha-galactosidase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=aglD PE=1 SV=2 3 141 2.0E-12
sp|A4DA70|AGALD_ASPFU Probable alpha-galactosidase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=aglD PE=3 SV=2 3 220 3.0E-12
sp|B0YEK2|AGALD_ASPFC Probable alpha-galactosidase D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=aglD PE=3 SV=2 3 220 3.0E-12
sp|Q2UI87|AGALD_ASPOR Probable alpha-galactosidase D OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=aglD PE=3 SV=2 3 204 3.0E-12
sp|Q66H12|NAGAB_RAT Alpha-N-acetylgalactosaminidase OS=Rattus norvegicus GN=Naga PE=2 SV=1 9 178 7.0E-12
sp|A1D9S3|AGALD_NEOFI Probable alpha-galactosidase D OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=aglD PE=3 SV=1 3 224 8.0E-12
sp|Q9QWR8|NAGAB_MOUSE Alpha-N-acetylgalactosaminidase OS=Mus musculus GN=Naga PE=1 SV=2 9 178 8.0E-12
sp|B8N306|AGALB_ASPFN Probable alpha-galactosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=aglB PE=3 SV=1 3 180 5.0E-11
sp|P51569|AGAL_MOUSE Alpha-galactosidase A OS=Mus musculus GN=Gla PE=1 SV=1 45 157 5.0E-11
sp|P06280|AGAL_HUMAN Alpha-galactosidase A OS=Homo sapiens GN=GLA PE=1 SV=1 5 157 6.0E-11
sp|Q2UJ97|AGALB_ASPOR Probable alpha-galactosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=aglB PE=3 SV=1 3 180 7.0E-11
sp|Q99172|MEL_LACCI Alpha-galactosidase OS=Lachancea cidri GN=MEL PE=3 SV=1 39 156 9.0E-11
sp|P17050|NAGAB_HUMAN Alpha-N-acetylgalactosaminidase OS=Homo sapiens GN=NAGA PE=1 SV=2 9 177 1.0E-10
sp|A7XZT2|AGALB_TALEM Probable alpha-galactosidase B OS=Talaromyces emersonii PE=3 SV=1 49 205 2.0E-10
sp|Q9URZ0|AGAL_SCHPO Alpha-galactosidase mel1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mel1 PE=3 SV=1 48 206 2.0E-10
sp|Q9Y865|AGALB_ASPNG Probable alpha-galactosidase B OS=Aspergillus niger GN=aglB PE=2 SV=1 3 204 4.0E-10
sp|A2QEJ9|AGALB_ASPNC Probable alpha-galactosidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=aglB PE=3 SV=1 3 204 5.0E-10
sp|Q58DH9|NAGAB_BOVIN Alpha-N-acetylgalactosaminidase OS=Bos taurus GN=NAGA PE=2 SV=1 9 177 8.0E-10
sp|P41945|MEL2_YEASX Alpha-galactosidase 2 OS=Saccharomyces cerevisiae GN=MEL2 PE=3 SV=1 46 175 8.0E-10
sp|Q9P4V4|MEL_ZYGMR Alpha-galactosidase OS=Zygotorulaspora mrakii GN=MEL PE=3 SV=1 39 144 1.0E-09
sp|P41946|MEL5_YEASX Alpha-galactosidase 5 OS=Saccharomyces cerevisiae GN=MEL5 PE=3 SV=1 46 175 7.0E-09
sp|P41947|MEL6_YEASX Alpha-galactosidase 6 OS=Saccharomyces cerevisiae GN=MEL6 PE=3 SV=1 46 175 7.0E-09
sp|O94221|AGALB_PENSI Probable alpha-galactosidase B OS=Penicillium simplicissimum GN=agl1 PE=2 SV=1 15 114 2.0E-08
sp|A1D0A3|AGALB_NEOFI Probable alpha-galactosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=aglB PE=3 SV=1 3 111 2.0E-08
sp|P04824|MEL1_YEASX Alpha-galactosidase 1 OS=Saccharomyces cerevisiae GN=MEL1 PE=1 SV=1 46 161 3.0E-08
sp|Q4WE86|AGALB_ASPFU Probable alpha-galactosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=aglB PE=3 SV=2 3 111 1.0E-07
sp|Q11129|MEL_SACMI Alpha-galactosidase OS=Saccharomyces mikatae GN=MEL PE=3 SV=1 46 158 1.0E-07
sp|B0Y224|AGALB_ASPFC Probable alpha-galactosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=aglB PE=3 SV=1 3 111 1.0E-07
sp|Q03647|MEL_SACCA Alpha-galactosidase OS=Saccharomyces pastorianus (strain ATCC 76529 / Carlsberg bottom yeast no.1 / CBS 1513 / CLIB 176 / NBRC 1167 / NCYC 396 / NRRL Y-12693) GN=MEL PE=3 SV=1 46 158 1.0E-07
sp|A1C5D3|AGALB_ASPCL Probable alpha-galactosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=aglB PE=3 SV=1 3 111 3.0E-07
sp|Q09187|MEL_SACPA Alpha-galactosidase OS=Saccharomyces paradoxus GN=MEL PE=3 SV=1 46 160 1.0E-06
sp|Q5AVQ6|AGALB_EMENI Probable alpha-galactosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=aglB PE=2 SV=2 3 180 2.0E-06
sp|Q9UVD6|MEL_TORDE Alpha-galactosidase OS=Torulaspora delbrueckii GN=MEL PE=3 SV=1 46 143 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0044238 primary metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5089
MGWAQQYGHLARHSADIQTYPDGNSWNSMLYNYGQHVRLARYQKPGFFNDPDFLNVDHPSYTLEEKKSHFALWCV
FSAPLLLSADLTAIKDEEVKYLTNRDLLAINQDRLVQQATLVSRDSTWDVLTKSVQNGDRILAILNRGNVPADHT
VTWEKLGFPASTRQSVGEIVVKNLWTGDSLRIPANRGGVTAKAIPAHGTAVFRITKPAGPVTPTGLIFKSDNLKC
LSDIRPGTMRWVTCNGLDSQTWQVRQDGRISSLLRPEKCAVNVQGKIRAHDCGSEADAWNYHVTGNLVSAKTNLC
LTEATNGDAIATACGYLRNEQVLSLPVGVAVLGQ*
Coding >Hirsu2|5089
ATGGGCTGGGCGCAGCAGTACGGACATTTGGCCCGCCACTCGGCCGACATCCAGACTTACCCGGACGGAAATTCC
TGGAACAGCATGTTATACAACTACGGACAACACGTTCGCTTGGCTCGATACCAGAAGCCGGGCTTTTTCAACGAC
CCGGATTTTCTGAATGTCGACCACCCCTCTTACACTTTGGAGGAGAAGAAGTCCCATTTTGCGCTCTGGTGCGTC
TTTTCGGCGCCATTGCTGCTCAGCGCAGACCTTACGGCCATCAAGGACGAAGAGGTCAAGTACCTGACCAATCGC
GATCTCCTGGCAATAAACCAAGACAGACTTGTCCAGCAAGCCACTCTCGTAAGCCGGGATTCAACATGGGACGTC
TTGACCAAGAGTGTCCAGAACGGCGATCGAATCCTGGCAATCCTGAACAGAGGAAACGTCCCTGCCGACCACACC
GTCACTTGGGAGAAGCTCGGCTTCCCCGCCAGTACTCGACAGAGCGTGGGGGAGATTGTCGTCAAGAACCTCTGG
ACTGGAGACAGCCTTAGAATCCCAGCGAATAGGGGTGGAGTGACCGCTAAAGCTATTCCTGCGCATGGAACCGCC
GTGTTTCGCATTACCAAGCCTGCTGGTCCCGTCACGCCTACTGGCCTTATCTTCAAGTCTGACAACTTGAAATGC
CTATCCGATATCAGGCCCGGTACGATGCGATGGGTGACTTGCAACGGTCTTGATAGCCAGACATGGCAAGTTAGA
CAAGACGGCCGCATTAGCAGCCTTCTGCGACCTGAAAAATGCGCCGTCAACGTCCAAGGTAAAATTCGTGCGCAT
GACTGTGGCAGCGAGGCGGACGCTTGGAACTATCATGTAACAGGAAATCTGGTGAGCGCCAAGACCAACCTTTGC
TTGACCGAGGCGACGAATGGGGACGCCATTGCCACCGCGTGCGGCTACCTGCGTAACGAGCAGGTGCTGAGTCTT
CCGGTCGGAGTTGCTGTCCTGGGACAATGA
Transcript >Hirsu2|5089
ATGGGCTGGGCGCAGCAGTACGGACATTTGGCCCGCCACTCGGCCGACATCCAGACTTACCCGGACGGAAATTCC
TGGAACAGCATGTTATACAACTACGGACAACACGTTCGCTTGGCTCGATACCAGAAGCCGGGCTTTTTCAACGAC
CCGGATTTTCTGAATGTCGACCACCCCTCTTACACTTTGGAGGAGAAGAAGTCCCATTTTGCGCTCTGGTGCGTC
TTTTCGGCGCCATTGCTGCTCAGCGCAGACCTTACGGCCATCAAGGACGAAGAGGTCAAGTACCTGACCAATCGC
GATCTCCTGGCAATAAACCAAGACAGACTTGTCCAGCAAGCCACTCTCGTAAGCCGGGATTCAACATGGGACGTC
TTGACCAAGAGTGTCCAGAACGGCGATCGAATCCTGGCAATCCTGAACAGAGGAAACGTCCCTGCCGACCACACC
GTCACTTGGGAGAAGCTCGGCTTCCCCGCCAGTACTCGACAGAGCGTGGGGGAGATTGTCGTCAAGAACCTCTGG
ACTGGAGACAGCCTTAGAATCCCAGCGAATAGGGGTGGAGTGACCGCTAAAGCTATTCCTGCGCATGGAACCGCC
GTGTTTCGCATTACCAAGCCTGCTGGTCCCGTCACGCCTACTGGCCTTATCTTCAAGTCTGACAACTTGAAATGC
CTATCCGATATCAGGCCCGGTACGATGCGATGGGTGACTTGCAACGGTCTTGATAGCCAGACATGGCAAGTTAGA
CAAGACGGCCGCATTAGCAGCCTTCTGCGACCTGAAAAATGCGCCGTCAACGTCCAAGGTAAAATTCGTGCGCAT
GACTGTGGCAGCGAGGCGGACGCTTGGAACTATCATGTAACAGGAAATCTGGTGAGCGCCAAGACCAACCTTTGC
TTGACCGAGGCGACGAATGGGGACGCCATTGCCACCGCGTGCGGCTACCTGCGTAACGAGCAGGTGCTGAGTCTT
CCGGTCGGAGTTGCTGTCCTGGGACAATGA
Gene >Hirsu2|5089
ATGGGCTGGGCGCAGCAGTACGGACATTTGGCCCGCCACTCGGCCGACATCCAGACTTACCCGGACGGAAATTCC
TGGAACAGCATGTTATACAACTACGGACAACACGTTCGCTTGGCTCGATACCAGAAGCCGGGCTTTTTCAACGAC
CCGGATTTTCTGAATGTCGACCACCCCTCTTACACTTTGGAGGAGAAGAAGTCCCATTTTGCGCTCTGGTGCGTC
TTTTCGGCGCCATTGCTGCTCAGCGCAGACCTTACGGCCATCAAGGACGAAGAGGTCAAGTACCTGACCAATCGC
GATCTCCTGGCAATAAACCAAGACAGACTTGTCCAGCAAGCCACTCTCGTAAGCCGGGATTCAACATGGGACGTC
TTGACCAAGAGTGTCCAGAACGGCGATCGAATCCTGGCAATCCTGAACAGAGGAAACGTCCCTGCCGACCACACC
GTCACTTGGGAGAAGCTCGGCTTCCCCGCCAGTACTCGACAGAGCGTGGGGGAGATTGTCGTCAAGAACCTCTGG
ACTGGAGACAGCCTTAGAATCCCAGCGAATAGGGGTGGAGTGACCGCTAAAGCTATTCCTGCGCATGGAACCGCC
GTGTTTCGCATTACCAAGCCTGCTGGTCCCGTCACGCCTACTGGCCTTATCTTCAAGTCTGACAACTTGAAATGC
CTATCCGATATCAGGCCCGGTACGATGCGATGGGTGACTTGCAACGGTCTTGATAGCCAGACATGGCAAGTTAGA
CAAGACGGCCGCATTAGCAGCCTTCTGCGACCTGAAAAATGCGCCGTCAACGTCCAAGGTAAAATTCGTGCGCAT
GACTGTGGCAGCGAGGCGGACGCTTGGAACTATCATGTAACAGGAAATCTGGTGAGCGCCAAGACCAACCTTTGC
TTGACCGAGGCGACGAATGGGGACGCCATTGCCACCGCGTGCGGCTACCTGCGTAACGAGCAGGTGCTGAGTCTT
CCGGTCGGAGTTGCTGTCCTGGGACAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail