Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5087
Gene name
LocationContig_255:6373..9232
Strand-
Gene length (bp)2859
Transcript length (bp)2859
Coding sequence length (bp)2859
Protein length (aa) 953

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18368 Ig_GlcNase Exo-beta-D-glucosaminidase Ig-fold domain 7.8E-30 783 896
PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2 3.9E-11 229 333

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4R1C4|EBDG_HYPJE Exo-beta-D-glucosaminidase OS=Hypocrea jecorina GN=gls93 PE=1 SV=1 18 903 0.0E+00
sp|D4AUH1|EBDG_ARTBC Exo-beta-D-glucosaminidase ARB_07888 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07888 PE=1 SV=1 13 901 0.0E+00
sp|C0LRA7|EBDG_HYPVI Exo-beta-D-glucosaminidase OS=Hypocrea virens GN=gls1 PE=2 SV=1 7 903 0.0E+00
sp|Q82NR8|EBDG_STRAW Exo-beta-D-glucosaminidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=csxA PE=1 SV=1 28 901 3.0E-177
sp|Q56F26|EBDG_AMYOR Exo-beta-D-glucosaminidase OS=Amycolatopsis orientalis GN=csxA PE=1 SV=2 39 905 4.0E-174
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4R1C4|EBDG_HYPJE Exo-beta-D-glucosaminidase OS=Hypocrea jecorina GN=gls93 PE=1 SV=1 18 903 0.0E+00
sp|D4AUH1|EBDG_ARTBC Exo-beta-D-glucosaminidase ARB_07888 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07888 PE=1 SV=1 13 901 0.0E+00
sp|C0LRA7|EBDG_HYPVI Exo-beta-D-glucosaminidase OS=Hypocrea virens GN=gls1 PE=2 SV=1 7 903 0.0E+00
sp|Q82NR8|EBDG_STRAW Exo-beta-D-glucosaminidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=csxA PE=1 SV=1 28 901 3.0E-177
sp|Q56F26|EBDG_AMYOR Exo-beta-D-glucosaminidase OS=Amycolatopsis orientalis GN=csxA PE=1 SV=2 39 905 4.0E-174
sp|Q75W54|EBM_ARATH Mannosylglycoprotein endo-beta-mannosidase OS=Arabidopsis thaliana GN=EBM PE=1 SV=3 42 881 8.0E-37
sp|Q5H7P5|EBM_LILLO Mannosylglycoprotein endo-beta-mannosidase OS=Lilium longiflorum GN=EBM PE=1 SV=4 76 879 3.0E-30
sp|Q0CCA0|MANBB_ASPTN Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mndB PE=3 SV=2 110 674 5.0E-16
sp|Q29444|MANBA_BOVIN Beta-mannosidase OS=Bos taurus GN=MANBA PE=1 SV=1 192 664 8.0E-15
sp|A1CGA8|MANBB_ASPCL Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mndB PE=3 SV=1 110 674 2.0E-14
sp|Q8K2I4|MANBA_MOUSE Beta-mannosidase OS=Mus musculus GN=Manba PE=1 SV=1 110 711 3.0E-14
sp|I2C092|MANBB_THIHE Beta-mannosidase B OS=Thielavia heterothallica GN=man9 PE=1 SV=1 110 675 3.0E-14
sp|Q5B7W2|MANBB_EMENI Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mndB PE=1 SV=2 110 674 3.0E-14
sp|Q2TXB7|MANBB_ASPOR Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mndB PE=3 SV=3 110 674 5.0E-14
sp|B8NW36|MANBB_ASPFN Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=mndB PE=3 SV=1 110 674 5.0E-14
sp|Q4FZV0|MANBA_RAT Beta-mannosidase OS=Rattus norvegicus GN=Manba PE=2 SV=1 110 664 1.0E-13
sp|A2QYN2|MANBB_ASPNC Beta-mannosidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mndB PE=3 SV=1 278 674 2.0E-13
sp|O00462|MANBA_HUMAN Beta-mannosidase OS=Homo sapiens GN=MANBA PE=2 SV=3 79 664 4.0E-13
sp|A1D911|MANBB_NEOFI Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=mndB PE=3 SV=1 110 674 7.0E-12
sp|Q95327|MANBA_CAPHI Beta-mannosidase OS=Capra hircus GN=MANBA PE=2 SV=1 192 664 1.0E-11
sp|Q4WAH4|MANBB_ASPFU Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mndB PE=3 SV=1 110 674 2.0E-10
sp|B0YBU9|MANBB_ASPFC Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=mndB PE=3 SV=1 110 674 3.0E-10
sp|A7LXS9|BGH2A_BACO1 Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / NCTC 11153) GN=BACOVA_02645 PE=1 SV=1 112 484 1.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0044238 primary metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5087
MPFPTTMFGYTFAILLLGHACKAASAQTRATSLAEKLIIPHWDLQSSAKVDRDLARVSQPGYDSSSWYHIQQSRC
TLMGCLLAAGVYNDSNLWFSDNLRHFDTSLFSVPWVYRNEFSLAPTDGQHYLLETNGVTSKADIYLNGDQIANKD
TQVGSFGGHTYDVTGLVSRRNALVISAHPGDFSYDLIQGFVDWNPSPPDNATGIWRDIYLRQTGPVSMGPASVSI
EMNTDVPLEDTSARVTVRAKAQNLVDHKVQLVVRSIVTDPTGRDNICEPVVVELSPGEFQLIEMDHQIDNPEIWW
PKQWGGQPLYKSELIFWVNSRVSDSSRQSFGIRTVTSGVNSHNDTLFTINGRPFQVIGGGYAPDHFFRWDRQRFL
AIARYTLDMGLNTIRLEGTLEHPELYEIADELGIMIMAGWVCCSKWEAWKYNTDLQLDPFPLWVDRDYETANASM
IHEAAMLQSHPSILAFLVGSDSWPNDRATKIYVDALKGAHWQTPVIASAAKRGYPELLGPSGLKMDGPYDWVPPS
YWYDTEPTKERLGAAFGFGSELGAGVGTPEYGSLKKFLAQKDLEDLWMRPEMDLFHMSANKSAFKNRRIYNEALF
QKYGPPTSLKDYLLKSQIMDYEATRAQHEGYASRWNAERPATGTIYWMLNNAWPALHWNLFDYAMHPAGSYFGAK
TAGRIQHVAYDYVDHSIWLINRSLHRSEACQVAVELIDLGGKVLSTQTLQALSKANTATKVGIVEGVGEVDQVAF
LRLILNGEEATLSRNVYWITKAVDTLEWKNSTWRHTPVSKFADFTSLSKMETARIRLTSPYPNTKRTCNVGKIDQ
EWRSLELENESSVPAFFIRLNLIDEMGDDVNPVIWSDNYITMWPREKITLEVNYAGGRVQDLAVEVSGGNIESSI
VHFNGPTKNNFDREPHIASAVPSRSTGDSRCPKDAIKEKGEKKDRSRLLNPM*
Coding >Hirsu2|5087
ATGCCCTTTCCCACGACCATGTTTGGATACACGTTTGCGATCCTCCTCCTCGGCCATGCCTGCAAAGCGGCCTCT
GCCCAGACCCGCGCGACCTCTCTGGCAGAGAAATTAATCATCCCACATTGGGACCTGCAGTCGTCGGCAAAAGTC
GACCGGGACCTCGCTCGAGTCTCCCAACCCGGCTACGACAGCTCATCGTGGTATCATATACAACAATCGCGCTGC
ACGCTTATGGGATGTCTCCTGGCGGCAGGCGTCTACAATGACTCGAATCTTTGGTTCTCCGACAATCTCAGACAT
TTCGACACCAGCCTGTTCTCCGTGCCTTGGGTTTACAGGAACGAGTTCTCGCTTGCGCCGACTGATGGGCAGCAC
TATTTACTAGAGACGAACGGGGTTACTTCTAAAGCGGATATATACCTGAATGGCGATCAAATTGCGAACAAGGAT
ACTCAGGTTGGATCTTTTGGCGGTCACACATACGACGTCACGGGCCTGGTGAGCCGCCGTAACGCGCTCGTAATT
AGCGCACATCCCGGCGACTTCAGCTATGATCTGATACAAGGGTTTGTCGACTGGAACCCGTCACCTCCCGACAAT
GCGACCGGAATCTGGCGAGACATCTACCTCAGGCAGACAGGCCCTGTGTCCATGGGCCCGGCAAGTGTGTCGATT
GAAATGAACACGGACGTGCCTCTGGAGGACACTTCGGCCAGGGTTACTGTGCGCGCAAAGGCCCAGAACCTTGTC
GATCACAAGGTGCAGCTCGTGGTTCGCTCGATCGTTACGGATCCTACTGGTCGCGACAATATCTGCGAGCCTGTC
GTCGTAGAGCTGAGTCCTGGAGAGTTTCAACTCATCGAAATGGACCATCAAATAGACAACCCCGAGATATGGTGG
CCGAAGCAGTGGGGCGGGCAACCATTGTACAAATCCGAGCTGATCTTCTGGGTCAATTCAAGGGTCTCCGACTCG
TCTCGACAATCCTTTGGGATCCGAACGGTTACATCAGGTGTAAACAGTCACAATGACACACTTTTCACAATCAAC
GGTCGACCTTTCCAGGTTATCGGCGGTGGCTATGCACCGGATCACTTTTTTCGGTGGGATAGACAGCGGTTTCTA
GCCATCGCGAGGTACACTCTCGATATGGGACTCAATACCATTAGGCTCGAGGGAACACTCGAACACCCCGAGCTA
TATGAGATTGCTGACGAGCTGGGAATCATGATCATGGCTGGCTGGGTCTGTTGCTCCAAGTGGGAGGCATGGAAG
TATAACACCGACTTGCAGCTTGACCCCTTTCCACTCTGGGTGGATAGGGATTATGAAACGGCTAATGCCAGTATG
ATCCACGAAGCAGCGATGCTTCAGAGCCACCCGAGCATCTTGGCTTTCCTTGTCGGGAGCGACTCCTGGCCTAAT
GATCGGGCGACCAAGATCTACGTTGACGCGCTCAAGGGTGCGCACTGGCAAACTCCCGTCATTGCCTCAGCTGCC
AAACGCGGATATCCGGAGTTACTGGGCCCAAGCGGCTTGAAAATGGACGGCCCTTATGACTGGGTTCCCCCCAGC
TACTGGTACGATACGGAACCGACGAAAGAAAGATTAGGGGCTGCTTTCGGGTTTGGCTCTGAGCTGGGCGCTGGT
GTGGGAACCCCAGAATACGGCAGCCTTAAGAAGTTTCTCGCGCAGAAAGATTTGGAGGATCTCTGGATGCGACCG
GAAATGGACCTCTTTCACATGTCTGCAAACAAGTCCGCCTTCAAAAACCGGAGAATCTACAACGAGGCACTGTTT
CAGAAATATGGCCCGCCAACGTCTTTGAAGGACTACTTGCTCAAGTCTCAGATTATGGACTATGAGGCCACCCGA
GCGCAGCACGAAGGGTACGCATCGCGATGGAATGCCGAGCGCCCAGCCACCGGGACGATCTACTGGATGCTCAAC
AATGCTTGGCCGGCACTTCACTGGAATCTGTTCGACTATGCCATGCATCCCGCCGGATCTTACTTTGGTGCCAAA
ACAGCCGGCAGGATTCAGCATGTTGCCTACGACTACGTGGACCACAGTATCTGGCTCATCAATCGATCTCTCCAT
AGGTCCGAGGCATGCCAGGTCGCCGTGGAGCTGATCGATCTTGGTGGCAAAGTTTTGTCTACGCAAACTCTGCAA
GCCCTCAGCAAGGCGAATACAGCAACTAAGGTCGGGATAGTAGAGGGCGTTGGGGAGGTCGACCAGGTGGCCTTC
TTGCGACTAATTCTTAATGGGGAAGAGGCTACCTTGAGTCGCAACGTTTACTGGATCACGAAGGCCGTTGATACG
CTGGAATGGAAGAATTCAACTTGGCGCCATACTCCAGTTTCCAAGTTCGCCGATTTCACGTCCCTCTCCAAAATG
GAAACGGCTCGCATACGCCTCACCTCGCCGTATCCAAACACAAAGCGTACATGTAACGTGGGCAAGATCGACCAG
GAGTGGCGATCGCTCGAACTCGAGAATGAGTCATCAGTTCCTGCGTTTTTCATTCGCCTAAACTTGATTGATGAG
ATGGGAGACGACGTTAACCCGGTCATCTGGTCGGATAACTACATCACGATGTGGCCACGAGAGAAAATTACGCTC
GAGGTTAACTACGCAGGTGGTAGGGTTCAAGACTTGGCCGTGGAAGTCAGCGGAGGAAACATCGAATCCTCCATC
GTTCACTTCAACGGACCAACGAAGAACAATTTCGACCGCGAGCCTCACATCGCGAGCGCCGTGCCTTCAAGGTCG
ACCGGAGACAGCAGATGCCCAAAGGATGCCATCAAAGAAAAAGGGGAGAAAAAAGACCGCTCCCGGTTATTAAAT
CCTATGTGA
Transcript >Hirsu2|5087
ATGCCCTTTCCCACGACCATGTTTGGATACACGTTTGCGATCCTCCTCCTCGGCCATGCCTGCAAAGCGGCCTCT
GCCCAGACCCGCGCGACCTCTCTGGCAGAGAAATTAATCATCCCACATTGGGACCTGCAGTCGTCGGCAAAAGTC
GACCGGGACCTCGCTCGAGTCTCCCAACCCGGCTACGACAGCTCATCGTGGTATCATATACAACAATCGCGCTGC
ACGCTTATGGGATGTCTCCTGGCGGCAGGCGTCTACAATGACTCGAATCTTTGGTTCTCCGACAATCTCAGACAT
TTCGACACCAGCCTGTTCTCCGTGCCTTGGGTTTACAGGAACGAGTTCTCGCTTGCGCCGACTGATGGGCAGCAC
TATTTACTAGAGACGAACGGGGTTACTTCTAAAGCGGATATATACCTGAATGGCGATCAAATTGCGAACAAGGAT
ACTCAGGTTGGATCTTTTGGCGGTCACACATACGACGTCACGGGCCTGGTGAGCCGCCGTAACGCGCTCGTAATT
AGCGCACATCCCGGCGACTTCAGCTATGATCTGATACAAGGGTTTGTCGACTGGAACCCGTCACCTCCCGACAAT
GCGACCGGAATCTGGCGAGACATCTACCTCAGGCAGACAGGCCCTGTGTCCATGGGCCCGGCAAGTGTGTCGATT
GAAATGAACACGGACGTGCCTCTGGAGGACACTTCGGCCAGGGTTACTGTGCGCGCAAAGGCCCAGAACCTTGTC
GATCACAAGGTGCAGCTCGTGGTTCGCTCGATCGTTACGGATCCTACTGGTCGCGACAATATCTGCGAGCCTGTC
GTCGTAGAGCTGAGTCCTGGAGAGTTTCAACTCATCGAAATGGACCATCAAATAGACAACCCCGAGATATGGTGG
CCGAAGCAGTGGGGCGGGCAACCATTGTACAAATCCGAGCTGATCTTCTGGGTCAATTCAAGGGTCTCCGACTCG
TCTCGACAATCCTTTGGGATCCGAACGGTTACATCAGGTGTAAACAGTCACAATGACACACTTTTCACAATCAAC
GGTCGACCTTTCCAGGTTATCGGCGGTGGCTATGCACCGGATCACTTTTTTCGGTGGGATAGACAGCGGTTTCTA
GCCATCGCGAGGTACACTCTCGATATGGGACTCAATACCATTAGGCTCGAGGGAACACTCGAACACCCCGAGCTA
TATGAGATTGCTGACGAGCTGGGAATCATGATCATGGCTGGCTGGGTCTGTTGCTCCAAGTGGGAGGCATGGAAG
TATAACACCGACTTGCAGCTTGACCCCTTTCCACTCTGGGTGGATAGGGATTATGAAACGGCTAATGCCAGTATG
ATCCACGAAGCAGCGATGCTTCAGAGCCACCCGAGCATCTTGGCTTTCCTTGTCGGGAGCGACTCCTGGCCTAAT
GATCGGGCGACCAAGATCTACGTTGACGCGCTCAAGGGTGCGCACTGGCAAACTCCCGTCATTGCCTCAGCTGCC
AAACGCGGATATCCGGAGTTACTGGGCCCAAGCGGCTTGAAAATGGACGGCCCTTATGACTGGGTTCCCCCCAGC
TACTGGTACGATACGGAACCGACGAAAGAAAGATTAGGGGCTGCTTTCGGGTTTGGCTCTGAGCTGGGCGCTGGT
GTGGGAACCCCAGAATACGGCAGCCTTAAGAAGTTTCTCGCGCAGAAAGATTTGGAGGATCTCTGGATGCGACCG
GAAATGGACCTCTTTCACATGTCTGCAAACAAGTCCGCCTTCAAAAACCGGAGAATCTACAACGAGGCACTGTTT
CAGAAATATGGCCCGCCAACGTCTTTGAAGGACTACTTGCTCAAGTCTCAGATTATGGACTATGAGGCCACCCGA
GCGCAGCACGAAGGGTACGCATCGCGATGGAATGCCGAGCGCCCAGCCACCGGGACGATCTACTGGATGCTCAAC
AATGCTTGGCCGGCACTTCACTGGAATCTGTTCGACTATGCCATGCATCCCGCCGGATCTTACTTTGGTGCCAAA
ACAGCCGGCAGGATTCAGCATGTTGCCTACGACTACGTGGACCACAGTATCTGGCTCATCAATCGATCTCTCCAT
AGGTCCGAGGCATGCCAGGTCGCCGTGGAGCTGATCGATCTTGGTGGCAAAGTTTTGTCTACGCAAACTCTGCAA
GCCCTCAGCAAGGCGAATACAGCAACTAAGGTCGGGATAGTAGAGGGCGTTGGGGAGGTCGACCAGGTGGCCTTC
TTGCGACTAATTCTTAATGGGGAAGAGGCTACCTTGAGTCGCAACGTTTACTGGATCACGAAGGCCGTTGATACG
CTGGAATGGAAGAATTCAACTTGGCGCCATACTCCAGTTTCCAAGTTCGCCGATTTCACGTCCCTCTCCAAAATG
GAAACGGCTCGCATACGCCTCACCTCGCCGTATCCAAACACAAAGCGTACATGTAACGTGGGCAAGATCGACCAG
GAGTGGCGATCGCTCGAACTCGAGAATGAGTCATCAGTTCCTGCGTTTTTCATTCGCCTAAACTTGATTGATGAG
ATGGGAGACGACGTTAACCCGGTCATCTGGTCGGATAACTACATCACGATGTGGCCACGAGAGAAAATTACGCTC
GAGGTTAACTACGCAGGTGGTAGGGTTCAAGACTTGGCCGTGGAAGTCAGCGGAGGAAACATCGAATCCTCCATC
GTTCACTTCAACGGACCAACGAAGAACAATTTCGACCGCGAGCCTCACATCGCGAGCGCCGTGCCTTCAAGGTCG
ACCGGAGACAGCAGATGCCCAAAGGATGCCATCAAAGAAAAAGGGGAGAAAAAAGACCGCTCCCGGTTATTAAAT
CCTATGTGA
Gene >Hirsu2|5087
ATGCCCTTTCCCACGACCATGTTTGGATACACGTTTGCGATCCTCCTCCTCGGCCATGCCTGCAAAGCGGCCTCT
GCCCAGACCCGCGCGACCTCTCTGGCAGAGAAATTAATCATCCCACATTGGGACCTGCAGTCGTCGGCAAAAGTC
GACCGGGACCTCGCTCGAGTCTCCCAACCCGGCTACGACAGCTCATCGTGGTATCATATACAACAATCGCGCTGC
ACGCTTATGGGATGTCTCCTGGCGGCAGGCGTCTACAATGACTCGAATCTTTGGTTCTCCGACAATCTCAGACAT
TTCGACACCAGCCTGTTCTCCGTGCCTTGGGTTTACAGGAACGAGTTCTCGCTTGCGCCGACTGATGGGCAGCAC
TATTTACTAGAGACGAACGGGGTTACTTCTAAAGCGGATATATACCTGAATGGCGATCAAATTGCGAACAAGGAT
ACTCAGGTTGGATCTTTTGGCGGTCACACATACGACGTCACGGGCCTGGTGAGCCGCCGTAACGCGCTCGTAATT
AGCGCACATCCCGGCGACTTCAGCTATGATCTGATACAAGGGTTTGTCGACTGGAACCCGTCACCTCCCGACAAT
GCGACCGGAATCTGGCGAGACATCTACCTCAGGCAGACAGGCCCTGTGTCCATGGGCCCGGCAAGTGTGTCGATT
GAAATGAACACGGACGTGCCTCTGGAGGACACTTCGGCCAGGGTTACTGTGCGCGCAAAGGCCCAGAACCTTGTC
GATCACAAGGTGCAGCTCGTGGTTCGCTCGATCGTTACGGATCCTACTGGTCGCGACAATATCTGCGAGCCTGTC
GTCGTAGAGCTGAGTCCTGGAGAGTTTCAACTCATCGAAATGGACCATCAAATAGACAACCCCGAGATATGGTGG
CCGAAGCAGTGGGGCGGGCAACCATTGTACAAATCCGAGCTGATCTTCTGGGTCAATTCAAGGGTCTCCGACTCG
TCTCGACAATCCTTTGGGATCCGAACGGTTACATCAGGTGTAAACAGTCACAATGACACACTTTTCACAATCAAC
GGTCGACCTTTCCAGGTTATCGGCGGTGGCTATGCACCGGATCACTTTTTTCGGTGGGATAGACAGCGGTTTCTA
GCCATCGCGAGGTACACTCTCGATATGGGACTCAATACCATTAGGCTCGAGGGAACACTCGAACACCCCGAGCTA
TATGAGATTGCTGACGAGCTGGGAATCATGATCATGGCTGGCTGGGTCTGTTGCTCCAAGTGGGAGGCATGGAAG
TATAACACCGACTTGCAGCTTGACCCCTTTCCACTCTGGGTGGATAGGGATTATGAAACGGCTAATGCCAGTATG
ATCCACGAAGCAGCGATGCTTCAGAGCCACCCGAGCATCTTGGCTTTCCTTGTCGGGAGCGACTCCTGGCCTAAT
GATCGGGCGACCAAGATCTACGTTGACGCGCTCAAGGGTGCGCACTGGCAAACTCCCGTCATTGCCTCAGCTGCC
AAACGCGGATATCCGGAGTTACTGGGCCCAAGCGGCTTGAAAATGGACGGCCCTTATGACTGGGTTCCCCCCAGC
TACTGGTACGATACGGAACCGACGAAAGAAAGATTAGGGGCTGCTTTCGGGTTTGGCTCTGAGCTGGGCGCTGGT
GTGGGAACCCCAGAATACGGCAGCCTTAAGAAGTTTCTCGCGCAGAAAGATTTGGAGGATCTCTGGATGCGACCG
GAAATGGACCTCTTTCACATGTCTGCAAACAAGTCCGCCTTCAAAAACCGGAGAATCTACAACGAGGCACTGTTT
CAGAAATATGGCCCGCCAACGTCTTTGAAGGACTACTTGCTCAAGTCTCAGATTATGGACTATGAGGCCACCCGA
GCGCAGCACGAAGGGTACGCATCGCGATGGAATGCCGAGCGCCCAGCCACCGGGACGATCTACTGGATGCTCAAC
AATGCTTGGCCGGCACTTCACTGGAATCTGTTCGACTATGCCATGCATCCCGCCGGATCTTACTTTGGTGCCAAA
ACAGCCGGCAGGATTCAGCATGTTGCCTACGACTACGTGGACCACAGTATCTGGCTCATCAATCGATCTCTCCAT
AGGTCCGAGGCATGCCAGGTCGCCGTGGAGCTGATCGATCTTGGTGGCAAAGTTTTGTCTACGCAAACTCTGCAA
GCCCTCAGCAAGGCGAATACAGCAACTAAGGTCGGGATAGTAGAGGGCGTTGGGGAGGTCGACCAGGTGGCCTTC
TTGCGACTAATTCTTAATGGGGAAGAGGCTACCTTGAGTCGCAACGTTTACTGGATCACGAAGGCCGTTGATACG
CTGGAATGGAAGAATTCAACTTGGCGCCATACTCCAGTTTCCAAGTTCGCCGATTTCACGTCCCTCTCCAAAATG
GAAACGGCTCGCATACGCCTCACCTCGCCGTATCCAAACACAAAGCGTACATGTAACGTGGGCAAGATCGACCAG
GAGTGGCGATCGCTCGAACTCGAGAATGAGTCATCAGTTCCTGCGTTTTTCATTCGCCTAAACTTGATTGATGAG
ATGGGAGACGACGTTAACCCGGTCATCTGGTCGGATAACTACATCACGATGTGGCCACGAGAGAAAATTACGCTC
GAGGTTAACTACGCAGGTGGTAGGGTTCAAGACTTGGCCGTGGAAGTCAGCGGAGGAAACATCGAATCCTCCATC
GTTCACTTCAACGGACCAACGAAGAACAATTTCGACCGCGAGCCTCACATCGCGAGCGCCGTGCCTTCAAGGTCG
ACCGGAGACAGCAGATGCCCAAAGGATGCCATCAAAGAAAAAGGGGAGAAAAAAGACCGCTCCCGGTTATTAAAT
CCTATGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail