Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5085
Gene name
LocationContig_255:1994..3045
Strand+
Gene length (bp)1051
Transcript length (bp)996
Coding sequence length (bp)996
Protein length (aa) 332

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1513 0.1518 0.9008 0.0638 0.2305 0.0421 0.1449 0.199 0.2085 0.005

SignalP

SignalP signal predicted Location Score
Yes 1 - 18 0.999687

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup7052
Change Orthofinder run
Species Protein ID
Ophiocordyceps subramaniannii Hirsu2|5085 (this protein)
Ophiocordyceps subramaniannii Hirsu2|7722

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5085
MKNVGLLFGLCFGSTVTAQTVSMTSNVPAVVNLQDSFLVEAWENSACSGKRFEHIVVNDGTVPKCFNTAGKASLS
VANQGSCPNGHVQISYWEEADCRAGKRAGDDDYMSRNTCRQIPSDGRRIRSVSLQCQTPEAVEHNGVQHSRRQDC
QDDEDCDWEDLEATLNILNRLDRRQTVYIVGRGKSKKRAFVKQDGSIVEFTRGFDFASVAIGIDPKRQVSLKIAR
PFTECRLYAADRNPGWTTYGQGIGWPQECPSTKNGRKCNFMEFQIHDEDTMNTLSAGASFDGLPEFDVKLRNSGG
ETQDGGIMRWGKTMTVTLRDGHRKTTSIDFD*
Coding >Hirsu2|5085
ATGAAGAACGTCGGCCTACTCTTCGGTCTTTGCTTTGGCTCAACCGTCACTGCTCAGACAGTGTCCATGACATCA
AATGTCCCTGCAGTTGTCAATCTCCAGGATTCATTTCTTGTCGAGGCTTGGGAGAACAGCGCGTGTTCAGGCAAG
AGATTCGAGCACATCGTCGTGAACGACGGCACGGTCCCCAAATGTTTCAACACCGCCGGCAAAGCGTCACTTAGC
GTGGCGAATCAAGGTAGCTGCCCAAACGGTCATGTGCAAATTAGCTACTGGGAGGAGGCCGACTGCCGTGCCGGT
AAGCGCGCTGGTGACGACGACTACATGAGCAGAAACACTTGCCGCCAAATCCCGTCAGACGGCCGGAGGATTCGA
TCCGTGTCATTGCAATGCCAGACTCCAGAAGCAGTCGAGCATAATGGCGTTCAGCATTCAAGACGCCAAGATTGC
CAAGATGATGAAGACTGCGACTGGGAGGATCTTGAGGCCACACTCAACATTCTCAATAGGTTAGATCGACGACAA
ACAGTTTACATCGTGGGGCGTGGAAAGAGCAAGAAACGGGCCTTTGTTAAGCAAGATGGTTCCATCGTGGAGTTC
ACCAGGGGCTTCGACTTTGCGAGCGTCGCCATTGGCATCGATCCGAAACGCCAAGTGTCACTCAAGATCGCACGC
CCCTTCACAGAGTGTCGTCTTTACGCCGCCGACCGCAATCCCGGCTGGACAACTTATGGTCAAGGTATCGGGTGG
CCGCAGGAGTGTCCGTCCACCAAAAACGGCCGGAAGTGTAACTTCATGGAGTTCCAAATCCATGACGAGGATACG
ATGAATACCCTGTCTGCGGGCGCCAGTTTTGATGGCTTGCCGGAATTCGACGTGAAGCTCAGGAACAGCGGCGGC
GAAACTCAAGACGGGGGGATAATGCGGTGGGGAAAGACAATGACTGTGACGCTCAGGGATGGCCACCGAAAGACA
ACCAGCATTGACTTCGATTAA
Transcript >Hirsu2|5085
ATGAAGAACGTCGGCCTACTCTTCGGTCTTTGCTTTGGCTCAACCGTCACTGCTCAGACAGTGTCCATGACATCA
AATGTCCCTGCAGTTGTCAATCTCCAGGATTCATTTCTTGTCGAGGCTTGGGAGAACAGCGCGTGTTCAGGCAAG
AGATTCGAGCACATCGTCGTGAACGACGGCACGGTCCCCAAATGTTTCAACACCGCCGGCAAAGCGTCACTTAGC
GTGGCGAATCAAGGTAGCTGCCCAAACGGTCATGTGCAAATTAGCTACTGGGAGGAGGCCGACTGCCGTGCCGGT
AAGCGCGCTGGTGACGACGACTACATGAGCAGAAACACTTGCCGCCAAATCCCGTCAGACGGCCGGAGGATTCGA
TCCGTGTCATTGCAATGCCAGACTCCAGAAGCAGTCGAGCATAATGGCGTTCAGCATTCAAGACGCCAAGATTGC
CAAGATGATGAAGACTGCGACTGGGAGGATCTTGAGGCCACACTCAACATTCTCAATAGGTTAGATCGACGACAA
ACAGTTTACATCGTGGGGCGTGGAAAGAGCAAGAAACGGGCCTTTGTTAAGCAAGATGGTTCCATCGTGGAGTTC
ACCAGGGGCTTCGACTTTGCGAGCGTCGCCATTGGCATCGATCCGAAACGCCAAGTGTCACTCAAGATCGCACGC
CCCTTCACAGAGTGTCGTCTTTACGCCGCCGACCGCAATCCCGGCTGGACAACTTATGGTCAAGGTATCGGGTGG
CCGCAGGAGTGTCCGTCCACCAAAAACGGCCGGAAGTGTAACTTCATGGAGTTCCAAATCCATGACGAGGATACG
ATGAATACCCTGTCTGCGGGCGCCAGTTTTGATGGCTTGCCGGAATTCGACGTGAAGCTCAGGAACAGCGGCGGC
GAAACTCAAGACGGGGGGATAATGCGGTGGGGAAAGACAATGACTGTGACGCTCAGGGATGGCCACCGAAAGACA
ACCAGCATTGACTTCGATTAA
Gene >Hirsu2|5085
ATGAAGAACGTCGGCCTACTCTTCGGTCTTTGCTTTGGCTCAACCGTCACTGCTCAGACAGTGTCCATGACATCA
AATGTTGGTGGCAGCCACGCCATTCCTCGGTACCAAGCCCAGCTGACCGGTCTGCCAGGTCCCTGCAGTTGTCAA
TCTCCAGGATTCATTTCTTGTCGAGGCTTGGGAGAACAGCGCGTGTTCAGGCAAGAGATTCGAGCACATCGTCGT
GAACGACGGCACGGTCCCCAAATGTTTCAACACCGCCGGCAAAGCGTCACTTAGCGTGGCGAATCAAGGTAGCTG
CCCAAACGGTCATGTGCAAATTAGCTACTGGGAGGAGGCCGACTGCCGTGCCGGTAAGCGCGCTGGTGACGACGA
CTACATGAGCAGAAACACTTGCCGCCAAATCCCGTCAGACGGCCGGAGGATTCGATCCGTGTCATTGCAATGCCA
GACTCCAGAAGCAGTCGAGCATAATGGCGTTCAGCATTCAAGACGCCAAGATTGCCAAGATGATGAAGACTGCGA
CTGGGAGGATCTTGAGGCCACACTCAACATTCTCAATAGGTTAGATCGACGACAAACAGTTTACATCGTGGGGCG
TGGAAAGAGCAAGAAACGGGCCTTTGTTAAGCAAGATGGTTCCATCGTGGAGTTCACCAGGGGCTTCGACTTTGC
GAGCGTCGCCATTGGCATCGATCCGAAACGCCAAGTGTCACTCAAGATCGCACGCCCCTTCACAGAGTGTCGTCT
TTACGCCGCCGACCGCAATCCCGGCTGGACAACTTATGGTCAAGGTATCGGGTGGCCGCAGGAGTGTCCGTCCAC
CAAAAACGGCCGGAAGTGTAACTTCATGGAGTTCCAAATCCATGACGAGGATACGATGAATACCCTGTCTGCGGG
CGCCAGTTTTGATGGCTTGCCGGAATTCGACGTGAAGCTCAGGAACAGCGGCGGCGAAACTCAAGACGGGGGGAT
AATGCGGTGGGGAAAGACAATGACTGTGACGCTCAGGGATGGCCACCGAAAGACAACCAGCATTGACTTCGATTA
A

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail