Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5083
Gene name
LocationContig_2548:209..530
Strand-
Gene length (bp)321
Transcript length (bp)243
Coding sequence length (bp)243
Protein length (aa) 81

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 1.5E-12 9 54
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 4.3E-08 6 45
PF12831 FAD_oxidored FAD dependent oxidoreductase 1.9E-07 7 43
PF01266 DAO FAD dependent oxidoreductase 2.0E-07 7 41
PF01593 Amino_oxidase Flavin containing amine oxidoreductase 1.9E-07 15 52
PF00890 FAD_binding_2 FAD binding domain 2.3E-07 7 41
PF03486 HI0933_like HI0933-like protein 2.1E-06 6 40
PF01494 FAD_binding_3 FAD binding domain 7.4E-06 6 36
PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 8.7E-05 6 39

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P48537|CRTI_CERNC Phytoene desaturase OS=Cercospora nicotianae GN=PDH1 PE=3 SV=1 5 51 1.0E-14
sp|Q8NUQ6|CRTN_STAAW Dehydrosqualene desaturase OS=Staphylococcus aureus (strain MW2) GN=crtN PE=3 SV=1 7 51 5.0E-07
sp|Q6G6B3|CRTN_STAAS Dehydrosqualene desaturase OS=Staphylococcus aureus (strain MSSA476) GN=crtN PE=3 SV=1 7 51 5.0E-07
sp|Q6GDN7|CRTN_STAAR Dehydrosqualene desaturase OS=Staphylococcus aureus (strain MRSA252) GN=crtN PE=3 SV=1 7 51 5.0E-07
sp|Q7A3E2|CRTN_STAAN Dehydrosqualene desaturase OS=Staphylococcus aureus (strain N315) GN=crtN PE=1 SV=1 7 51 5.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P48537|CRTI_CERNC Phytoene desaturase OS=Cercospora nicotianae GN=PDH1 PE=3 SV=1 5 51 1.0E-14
sp|Q8NUQ6|CRTN_STAAW Dehydrosqualene desaturase OS=Staphylococcus aureus (strain MW2) GN=crtN PE=3 SV=1 7 51 5.0E-07
sp|Q6G6B3|CRTN_STAAS Dehydrosqualene desaturase OS=Staphylococcus aureus (strain MSSA476) GN=crtN PE=3 SV=1 7 51 5.0E-07
sp|Q6GDN7|CRTN_STAAR Dehydrosqualene desaturase OS=Staphylococcus aureus (strain MRSA252) GN=crtN PE=3 SV=1 7 51 5.0E-07
sp|Q7A3E2|CRTN_STAAN Dehydrosqualene desaturase OS=Staphylococcus aureus (strain N315) GN=crtN PE=1 SV=1 7 51 5.0E-07
sp|Q99R76|CRTN_STAAM Dehydrosqualene desaturase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=crtN PE=3 SV=1 7 51 5.0E-07
sp|O07855|CRTN_STAAE Dehydrosqualene desaturase OS=Staphylococcus aureus (strain Newman) GN=crtN PE=1 SV=2 7 51 5.0E-07
sp|Q2FV60|CRTN_STAA8 Dehydrosqualene desaturase OS=Staphylococcus aureus (strain NCTC 8325) GN=crtN PE=3 SV=1 7 51 5.0E-07
sp|Q2FDU6|CRTN_STAA3 Dehydrosqualene desaturase OS=Staphylococcus aureus (strain USA300) GN=crtN PE=3 SV=1 7 51 5.0E-07
sp|Q2YWE8|CRTN_STAAB Dehydrosqualene desaturase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=crtN PE=3 SV=1 7 51 7.0E-07
sp|P54982|CRTI_PHYB8 Phytoene desaturase OS=Phycomyces blakesleeanus (strain ATCC 8743b / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=carB PE=3 SV=1 22 51 6.0E-06
sp|P21334|CRTI_NEUCR Phytoene desaturase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=al-1 PE=1 SV=1 22 51 6.0E-06
sp|P54980|CRTI_RHOS4 Phytoene desaturase (neurosporene-forming) OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=crtI PE=3 SV=2 4 51 7.0E-06
sp|Q5HCY9|CRTN_STAAC Dehydrosqualene desaturase OS=Staphylococcus aureus (strain COL) GN=crtN PE=3 SV=1 7 51 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0071949 FAD binding Yes
GO:1901265 nucleoside phosphate binding No
GO:1901363 heterocyclic compound binding No
GO:0008150 biological_process No
GO:0048037 cofactor binding No
GO:0036094 small molecule binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0050660 flavin adenine dinucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0043168 anion binding No
GO:0003824 catalytic activity No
GO:0005488 binding No
GO:0050662 coenzyme binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5083
MDPAPSVLIVGAGAGGIATAARLAKRGCRVTVVEKNEFIGGRCSLIHRDGYVSLGLEAGHAAFLLTRGRGRDSTK
GRRCC*
Coding >Hirsu2|5083
ATGGACCCGGCCCCTTCCGTCCTCATCGTCGGCGCCGGCGCCGGCGGCATCGCCACGGCGGCCCGGCTGGCCAAG
CGCGGCTGCCGCGTGACGGTGGTGGAGAAGAACGAGTTCATCGGCGGCCGGTGCTCGCTCATCCACCGGGACGGC
TACGTGAGTCTTGGCCTCGAGGCCGGACACGCCGCCTTTCTTCTGACACGAGGGCGAGGCAGAGATTCGACCAAG
GGCCGTCGCTGCTGCTGA
Transcript >Hirsu2|5083
ATGGACCCGGCCCCTTCCGTCCTCATCGTCGGCGCCGGCGCCGGCGGCATCGCCACGGCGGCCCGGCTGGCCAAG
CGCGGCTGCCGCGTGACGGTGGTGGAGAAGAACGAGTTCATCGGCGGCCGGTGCTCGCTCATCCACCGGGACGGC
TACGTGAGTCTTGGCCTCGAGGCCGGACACGCCGCCTTTCTTCTGACACGAGGGCGAGGCAGAGATTCGACCAAG
GGCCGTCGCTGCTGCTGA
Gene >Hirsu2|5083
ATGGACCCGGCCCCTTCCGTCCTCATCGTCGGTGAGCAAGAACCAGACCCCGGACCCTTTCTTCGGGGCTCCTCG
TCCTGACAGCGGTTCTCCCCTCCCGCGTCCGCAGGCGCCGGCGCCGGCGGCATCGCCACGGCGGCCCGGCTGGCC
AAGCGCGGCTGCCGCGTGACGGTGGTGGAGAAGAACGAGTTCATCGGCGGCCGGTGCTCGCTCATCCACCGGGAC
GGCTACGTGAGTCTTGGCCTCGAGGCCGGACACGCCGCCTTTCTTCTGACACGAGGGCGAGGCAGAGATTCGACC
AAGGGCCGTCGCTGCTGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail