Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5081
Gene name
LocationContig_2546:39..1735
Strand+
Gene length (bp)1696
Transcript length (bp)1191
Coding sequence length (bp)1191
Protein length (aa) 397

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00464 SHMT Serine hydroxymethyltransferase 4.1E-100 14 216
PF00464 SHMT Serine hydroxymethyltransferase 1.7E-38 217 328

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S5N8|GLYM_NEUCR Putative serine hydroxymethyltransferase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cbs-2 PE=3 SV=2 1 216 2.0E-132
sp|O13425|GLYM_CANAX Serine hydroxymethyltransferase, mitochondrial OS=Candida albicans GN=SHM1 PE=3 SV=1 7 216 4.0E-103
sp|Q10104|GLYM_SCHPO Serine hydroxymethyltransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shm2 PE=3 SV=2 6 216 2.0E-102
sp|Q6CLQ5|GLYM_KLULA Serine hydroxymethyltransferase, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SHM1 PE=3 SV=1 7 216 1.0E-101
sp|Q6FQ44|GLYM_CANGA Serine hydroxymethyltransferase, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SHM1 PE=3 SV=1 6 216 1.0E-100
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S5N8|GLYM_NEUCR Putative serine hydroxymethyltransferase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cbs-2 PE=3 SV=2 1 216 2.0E-132
sp|O13425|GLYM_CANAX Serine hydroxymethyltransferase, mitochondrial OS=Candida albicans GN=SHM1 PE=3 SV=1 7 216 4.0E-103
sp|Q10104|GLYM_SCHPO Serine hydroxymethyltransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shm2 PE=3 SV=2 6 216 2.0E-102
sp|Q6CLQ5|GLYM_KLULA Serine hydroxymethyltransferase, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SHM1 PE=3 SV=1 7 216 1.0E-101
sp|Q6FQ44|GLYM_CANGA Serine hydroxymethyltransferase, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SHM1 PE=3 SV=1 6 216 1.0E-100
sp|Q9SZJ5|GLYM1_ARATH Serine hydroxymethyltransferase 1, mitochondrial OS=Arabidopsis thaliana GN=SHM1 PE=1 SV=1 10 216 9.0E-99
sp|O13426|GLYC_CANAL Serine hydroxymethyltransferase, cytosolic OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SHM2 PE=1 SV=4 6 216 1.0E-98
sp|P49357|GLYM1_FLAPR Serine hydroxymethyltransferase 1, mitochondrial OS=Flaveria pringlei PE=2 SV=1 10 216 3.0E-98
sp|Q94C74|GLYM2_ARATH Serine hydroxymethyltransferase 2, mitochondrial OS=Arabidopsis thaliana GN=SHM2 PE=2 SV=2 10 216 7.0E-98
sp|P50433|GLYM_SOLTU Serine hydroxymethyltransferase, mitochondrial OS=Solanum tuberosum PE=2 SV=1 10 216 9.0E-98
sp|P34899|GLYM_PEA Serine hydroxymethyltransferase, mitochondrial OS=Pisum sativum PE=1 SV=1 10 216 1.0E-97
sp|Q758F0|GLYM_ASHGO Serine hydroxymethyltransferase, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SHM1 PE=3 SV=1 7 216 1.0E-96
sp|Q75BQ6|GLYC_ASHGO Serine hydroxymethyltransferase, cytosolic OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SHM2 PE=3 SV=2 4 216 1.0E-96
sp|O13972|GLYD_SCHPO Probable serine hydroxymethyltransferase, cytosolic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24C9.12c PE=3 SV=1 3 216 5.0E-96
sp|P37292|GLYM_YEAST Serine hydroxymethyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SHM1 PE=1 SV=2 4 216 2.0E-95
sp|P49358|GLYM2_FLAPR Serine hydroxymethyltransferase 2, mitochondrial OS=Flaveria pringlei PE=2 SV=1 10 216 2.0E-95
sp|Q6FUP6|GLYC_CANGA Serine hydroxymethyltransferase, cytosolic OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SHM2 PE=3 SV=1 4 216 2.0E-95
sp|P37291|GLYC_YEAST Serine hydroxymethyltransferase, cytosolic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SHM2 PE=1 SV=2 4 216 7.0E-94
sp|P34898|GLYC_NEUCR Serine hydroxymethyltransferase, cytosolic OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=for PE=3 SV=2 4 216 8.0E-94
sp|P50432|GLYC_CAEEL Serine hydroxymethyltransferase OS=Caenorhabditis elegans GN=mel-32 PE=1 SV=2 7 216 3.0E-93
sp|Q60V73|GLYC_CAEBR Serine hydroxymethyltransferase OS=Caenorhabditis briggsae GN=mel-32 PE=3 SV=3 7 216 7.0E-93
sp|Q7S5N8|GLYM_NEUCR Putative serine hydroxymethyltransferase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cbs-2 PE=3 SV=2 209 395 1.0E-88
sp|Q94JQ3|GLYP3_ARATH Serine hydroxymethyltransferase 3, chloroplastic OS=Arabidopsis thaliana GN=SHM3 PE=1 SV=2 14 216 3.0E-86
sp|P34897|GLYM_HUMAN Serine hydroxymethyltransferase, mitochondrial OS=Homo sapiens GN=SHMT2 PE=1 SV=3 14 216 9.0E-86
sp|Q3SZ20|GLYM_BOVIN Serine hydroxymethyltransferase, mitochondrial OS=Bos taurus GN=SHMT2 PE=2 SV=1 14 216 9.0E-85
sp|P14519|GLYM_RABIT Serine hydroxymethyltransferase, mitochondrial OS=Oryctolagus cuniculus GN=SHMT2 PE=1 SV=2 14 216 8.0E-84
sp|P50431|GLYC_MOUSE Serine hydroxymethyltransferase, cytosolic OS=Mus musculus GN=Shmt1 PE=1 SV=3 6 216 2.0E-81
sp|Q5RFK5|GLYC_PONAB Serine hydroxymethyltransferase, cytosolic OS=Pongo abelii GN=SHMT1 PE=2 SV=1 8 216 4.0E-81
sp|O23254|GLYC4_ARATH Serine hydroxymethyltransferase 4 OS=Arabidopsis thaliana GN=SHM4 PE=1 SV=1 14 216 6.0E-81
sp|P07511|GLYC_RABIT Serine hydroxymethyltransferase, cytosolic OS=Oryctolagus cuniculus GN=SHMT1 PE=1 SV=2 6 216 1.0E-80
sp|P34896|GLYC_HUMAN Serine hydroxymethyltransferase, cytosolic OS=Homo sapiens GN=SHMT1 PE=1 SV=1 8 216 1.0E-80
sp|Q54Z26|GLYC1_DICDI Serine hydroxymethyltransferase 1 OS=Dictyostelium discoideum GN=shmt1 PE=1 SV=1 14 216 6.0E-80
sp|P35623|GLYC_SHEEP Serine hydroxymethyltransferase, cytosolic OS=Ovis aries GN=SHMT1 PE=1 SV=3 6 216 1.0E-79
sp|Q5E9P9|GLYC_BOVIN Serine hydroxymethyltransferase, cytosolic OS=Bos taurus GN=SHMT1 PE=2 SV=3 6 216 2.0E-78
sp|Q9SVM4|GLYC5_ARATH Serine hydroxymethyltransferase 5 OS=Arabidopsis thaliana GN=SHM5 PE=3 SV=1 11 216 2.0E-78
sp|Q54EW1|GLYC2_DICDI Serine hydroxymethyltransferase 2 OS=Dictyostelium discoideum GN=shmt2 PE=3 SV=1 14 216 2.0E-77
sp|Q07MT9|GLYA_RHOP5 Serine hydroxymethyltransferase OS=Rhodopseudomonas palustris (strain BisA53) GN=glyA PE=3 SV=1 8 329 1.0E-70
sp|Q9LM59|GLYC6_ARATH Serine hydroxymethyltransferase 6 OS=Arabidopsis thaliana GN=SHM6 PE=2 SV=1 14 216 2.0E-68
sp|Q84WV0|GLYC7_ARATH Serine hydroxymethyltransferase 7 OS=Arabidopsis thaliana GN=SHM7 PE=2 SV=1 17 216 2.0E-68
sp|Q3SRV3|GLYA_NITWN Serine hydroxymethyltransferase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=glyA PE=3 SV=1 9 329 2.0E-68
sp|Q1QMB9|GLYA_NITHX Serine hydroxymethyltransferase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=glyA PE=3 SV=1 9 363 3.0E-68
sp|O62585|GLYC_ENCCU Serine hydroxymethyltransferase, cytosolic OS=Encephalitozoon cuniculi (strain GB-M1) GN=SHMT-1 PE=3 SV=2 6 216 2.0E-66
sp|A0L403|GLYA_MAGMM Serine hydroxymethyltransferase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=glyA PE=3 SV=1 11 333 5.0E-66
sp|Q2IWS4|GLYA_RHOP2 Serine hydroxymethyltransferase OS=Rhodopseudomonas palustris (strain HaA2) GN=glyA PE=3 SV=1 9 343 1.0E-65
sp|B9JV74|GLYA_AGRVS Serine hydroxymethyltransferase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=glyA PE=3 SV=1 9 361 3.0E-65
sp|A0RQ16|GLYA_CAMFF Serine hydroxymethyltransferase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=glyA PE=3 SV=1 14 330 1.0E-64
sp|Q6N693|GLYA1_RHOPA Serine hydroxymethyltransferase 1 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=glyA1 PE=3 SV=1 9 343 1.0E-63
sp|A9IVC5|GLYA_BART1 Serine hydroxymethyltransferase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=glyA PE=3 SV=1 4 329 1.0E-63
sp|Q8UG75|GLYA1_AGRFC Serine hydroxymethyltransferase 1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=glyA1 PE=3 SV=2 9 329 1.0E-63
sp|A5GF66|GLYA_GEOUR Serine hydroxymethyltransferase OS=Geobacter uraniireducens (strain Rf4) GN=glyA PE=3 SV=1 14 334 3.0E-62
sp|B3QPR3|GLYA_CHLP8 Serine hydroxymethyltransferase OS=Chlorobaculum parvum (strain NCIB 8327) GN=glyA PE=3 SV=1 14 220 4.0E-62
sp|Q2KA25|GLYA_RHIEC Serine hydroxymethyltransferase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=glyA PE=3 SV=1 7 329 1.0E-61
sp|B9JCX4|GLYA_AGRRK Serine hydroxymethyltransferase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=glyA PE=3 SV=1 1 350 1.0E-61
sp|Q1MIU5|GLYA_RHIL3 Serine hydroxymethyltransferase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=glyA PE=3 SV=1 7 329 2.0E-61
sp|A7I3S9|GLYA_CAMHC Serine hydroxymethyltransferase OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=glyA PE=3 SV=1 12 330 5.0E-61
sp|Q8KC36|GLYA_CHLTE Serine hydroxymethyltransferase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=glyA PE=3 SV=1 14 220 8.0E-61
sp|Q6G3L3|GLYA_BARHE Serine hydroxymethyltransferase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=glyA PE=3 SV=1 4 390 1.0E-60
sp|Q3A934|GLYA_CARHZ Serine hydroxymethyltransferase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=glyA PE=3 SV=1 10 348 1.0E-60
sp|B3EMW0|GLYA_CHLPB Serine hydroxymethyltransferase OS=Chlorobium phaeobacteroides (strain BS1) GN=glyA PE=3 SV=2 14 220 1.0E-60
sp|Q28N04|GLYA_JANSC Serine hydroxymethyltransferase OS=Jannaschia sp. (strain CCS1) GN=glyA PE=3 SV=1 9 333 1.0E-60
sp|B8FJ72|GLYA_DESAA Serine hydroxymethyltransferase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=glyA PE=3 SV=1 14 355 2.0E-60
sp|Q7U2X3|GLYA2_MYCBO Serine hydroxymethyltransferase 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=glyA2 PE=3 SV=1 10 336 2.0E-60
sp|A0LV49|GLYA_ACIC1 Serine hydroxymethyltransferase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=glyA PE=3 SV=1 12 350 3.0E-60
sp|Q7V335|GLYA_PROMP Serine hydroxymethyltransferase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=glyA PE=3 SV=1 13 329 3.0E-60
sp|A9VYW6|GLYA_METEP Serine hydroxymethyltransferase OS=Methylobacterium extorquens (strain PA1) GN=glyA PE=3 SV=1 9 350 4.0E-60
sp|P50435|GLYA_METEA Serine hydroxymethyltransferase OS=Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / AM1) GN=glyA PE=3 SV=2 9 350 4.0E-60
sp|B7KVA7|GLYA_METC4 Serine hydroxymethyltransferase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=glyA PE=3 SV=1 9 350 4.0E-60
sp|Q1RGX5|GLYA_RICBR Serine hydroxymethyltransferase OS=Rickettsia bellii (strain RML369-C) GN=glyA PE=3 SV=1 8 330 6.0E-60
sp|A8GUH4|GLYA_RICB8 Serine hydroxymethyltransferase OS=Rickettsia bellii (strain OSU 85-389) GN=glyA PE=3 SV=1 8 330 6.0E-60
sp|B0UML5|GLYA_METS4 Serine hydroxymethyltransferase OS=Methylobacterium sp. (strain 4-46) GN=glyA PE=3 SV=1 9 350 1.0E-59
sp|Q9K6G4|GLYA_BACHD Serine hydroxymethyltransferase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=glyA PE=3 SV=1 14 338 1.0E-59
sp|A5CYB7|GLYA_PELTS Serine hydroxymethyltransferase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=glyA PE=3 SV=1 14 333 3.0E-59
sp|B1ZJN1|GLYA_METPB Serine hydroxymethyltransferase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=glyA PE=3 SV=1 9 329 4.0E-59
sp|Q3APN5|GLYA_CHLCH Serine hydroxymethyltransferase OS=Chlorobium chlorochromatii (strain CaD3) GN=glyA PE=3 SV=1 14 220 5.0E-59
sp|Q5LPA8|GLYA_RUEPO Serine hydroxymethyltransferase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=glyA1 PE=3 SV=1 9 350 6.0E-59
sp|B4RB35|GLYA_PHEZH Serine hydroxymethyltransferase OS=Phenylobacterium zucineum (strain HLK1) GN=glyA PE=3 SV=1 17 325 8.0E-59
sp|B1KJJ9|GLYA_SHEWM Serine hydroxymethyltransferase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=glyA PE=3 SV=1 18 330 2.0E-58
sp|Q5ZXK6|GLYA_LEGPH Serine hydroxymethyltransferase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=glyA PE=3 SV=1 11 216 5.0E-58
sp|Q5X722|GLYA_LEGPA Serine hydroxymethyltransferase OS=Legionella pneumophila (strain Paris) GN=glyA PE=3 SV=1 11 216 5.0E-58
sp|A5IGI2|GLYA_LEGPC Serine hydroxymethyltransferase OS=Legionella pneumophila (strain Corby) GN=glyA PE=3 SV=1 11 216 6.0E-58
sp|B4SE31|GLYA_PELPB Serine hydroxymethyltransferase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=glyA PE=3 SV=1 14 220 6.0E-58
sp|Q5WYH4|GLYA_LEGPL Serine hydroxymethyltransferase OS=Legionella pneumophila (strain Lens) GN=glyA PE=3 SV=1 11 216 6.0E-58
sp|B4S5Y9|GLYA_PROA2 Serine hydroxymethyltransferase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=glyA PE=3 SV=1 14 220 7.0E-58
sp|B9KAQ7|GLYA_THENN Serine hydroxymethyltransferase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=glyA PE=3 SV=1 13 216 8.0E-58
sp|B1LZ88|GLYA_METRJ Serine hydroxymethyltransferase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=glyA PE=3 SV=1 9 329 1.0E-57
sp|Q3B2I7|GLYA_CHLL7 Serine hydroxymethyltransferase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=glyA PE=3 SV=1 14 220 1.0E-57
sp|B9MR57|GLYA_CALBD Serine hydroxymethyltransferase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=glyA PE=3 SV=1 14 334 1.0E-57
sp|Q8TK94|GLYA_METAC Serine hydroxymethyltransferase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=glyA PE=3 SV=1 12 216 1.0E-57
sp|Q4FLT4|GLYA_PELUB Serine hydroxymethyltransferase OS=Pelagibacter ubique (strain HTCC1062) GN=glyA PE=3 SV=1 14 333 1.0E-57
sp|Q8FQR1|GLYA_COREF Serine hydroxymethyltransferase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=glyA PE=3 SV=2 14 334 2.0E-57
sp|A1USI0|GLYA_BARBK Serine hydroxymethyltransferase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=glyA PE=3 SV=1 4 333 3.0E-57
sp|Q6G009|GLYA_BARQU Serine hydroxymethyltransferase OS=Bartonella quintana (strain Toulouse) GN=glyA PE=3 SV=1 4 390 3.0E-57
sp|Q8PZQ0|GLYA_METMA Serine hydroxymethyltransferase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=glyA PE=3 SV=2 12 216 4.0E-57
sp|A6TQQ1|GLYA_ALKMQ Serine hydroxymethyltransferase OS=Alkaliphilus metalliredigens (strain QYMF) GN=glyA PE=3 SV=1 14 330 5.0E-57
sp|B7IHE6|GLYA_THEAB Serine hydroxymethyltransferase OS=Thermosipho africanus (strain TCF52B) GN=glyA PE=3 SV=1 13 216 5.0E-57
sp|Q1IS84|GLYA_KORVE Serine hydroxymethyltransferase OS=Koribacter versatilis (strain Ellin345) GN=glyA PE=3 SV=1 10 216 7.0E-57
sp|Q983B6|GLYA1_RHILO Serine hydroxymethyltransferase 1 OS=Rhizobium loti (strain MAFF303099) GN=glyA1 PE=3 SV=1 7 329 7.0E-57
sp|A7GGI2|GLYA_CLOBL Serine hydroxymethyltransferase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=glyA PE=3 SV=1 12 216 1.0E-56
sp|C1FTF1|GLYA_CLOBJ Serine hydroxymethyltransferase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=glyA PE=3 SV=1 12 216 1.0E-56
sp|A5IJ65|GLYA_THEP1 Serine hydroxymethyltransferase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=glyA PE=3 SV=1 13 216 1.0E-56
sp|B1IJJ8|GLYA_CLOBK Serine hydroxymethyltransferase OS=Clostridium botulinum (strain Okra / Type B1) GN=glyA PE=3 SV=1 12 216 1.0E-56
sp|B1L7Y6|GLYA_THESQ Serine hydroxymethyltransferase OS=Thermotoga sp. (strain RQ2) GN=glyA PE=3 SV=1 13 216 1.0E-56
sp|A6LKU9|GLYA_THEM4 Serine hydroxymethyltransferase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=glyA PE=3 SV=1 13 216 2.0E-56
sp|B9DMF3|GLYA_STACT Serine hydroxymethyltransferase OS=Staphylococcus carnosus (strain TM300) GN=glyA PE=3 SV=1 14 333 2.0E-56
sp|Q8R887|GLYA_CALS4 Serine hydroxymethyltransferase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=glyA PE=3 SV=1 14 216 2.0E-56
sp|A5I526|GLYA_CLOBH Serine hydroxymethyltransferase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=glyA PE=3 SV=1 12 216 3.0E-56
sp|A7FWM6|GLYA_CLOB1 Serine hydroxymethyltransferase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=glyA PE=3 SV=1 12 216 3.0E-56
sp|B0TI64|GLYA_HELMI Serine hydroxymethyltransferase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=glyA PE=3 SV=1 13 216 3.0E-56
sp|B1ZZW8|GLYA_OPITP Serine hydroxymethyltransferase OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=glyA PE=3 SV=1 14 350 4.0E-56
sp|B1KXQ5|GLYA_CLOBM Serine hydroxymethyltransferase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=glyA PE=3 SV=1 12 216 4.0E-56
sp|C3L181|GLYA_CLOB6 Serine hydroxymethyltransferase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=glyA PE=3 SV=1 12 216 4.0E-56
sp|Q97GV1|GLYA_CLOAB Serine hydroxymethyltransferase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=glyA PE=3 SV=1 13 333 4.0E-56
sp|A5N7P5|GLYA_CLOK5 Serine hydroxymethyltransferase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=glyA PE=3 SV=1 14 216 5.0E-56
sp|B9E156|GLYA_CLOK1 Serine hydroxymethyltransferase OS=Clostridium kluyveri (strain NBRC 12016) GN=glyA PE=3 SV=1 14 216 5.0E-56
sp|Q7MXW0|GLYA_PORGI Serine hydroxymethyltransferase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=glyA PE=3 SV=1 16 220 5.0E-56
sp|B2RGR2|GLYA_PORG3 Serine hydroxymethyltransferase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=glyA PE=3 SV=1 16 220 5.0E-56
sp|A4XL61|GLYA_CALS8 Serine hydroxymethyltransferase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=glyA PE=3 SV=1 14 334 6.0E-56
sp|B9KZ44|GLYA_THERP Serine hydroxymethyltransferase OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=glyA PE=3 SV=1 14 391 6.0E-56
sp|B3EFN5|GLYA_CHLL2 Serine hydroxymethyltransferase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=glyA PE=3 SV=2 14 220 8.0E-56
sp|C4ZH69|GLYA_EUBR3 Serine hydroxymethyltransferase OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=glyA PE=3 SV=1 14 216 1.0E-55
sp|B3PBD6|GLYA_CELJU Serine hydroxymethyltransferase OS=Cellvibrio japonicus (strain Ueda107) GN=glyA PE=3 SV=1 18 216 1.0E-55
sp|C5CEA8|GLYA_KOSOT Serine hydroxymethyltransferase OS=Kosmotoga olearia (strain TBF 19.5.1) GN=glyA PE=3 SV=1 14 216 1.0E-55
sp|Q9WZH9|GLYA_THEMA Serine hydroxymethyltransferase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=glyA PE=3 SV=1 13 216 1.0E-55
sp|Q2ST43|GLYA_MYCCT Serine hydroxymethyltransferase OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=glyA PE=3 SV=1 16 333 1.0E-55
sp|A0M3N2|GLYA_GRAFK Serine hydroxymethyltransferase OS=Gramella forsetii (strain KT0803) GN=glyA PE=3 SV=1 18 220 2.0E-55
sp|Q92QU6|GLYA1_RHIME Serine hydroxymethyltransferase 1 OS=Rhizobium meliloti (strain 1021) GN=glyA1 PE=3 SV=1 9 329 2.0E-55
sp|Q8G1F1|GLYA_BRUSU Serine hydroxymethyltransferase OS=Brucella suis biovar 1 (strain 1330) GN=glyA PE=3 SV=1 9 361 2.0E-55
sp|A9MAE5|GLYA_BRUC2 Serine hydroxymethyltransferase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=glyA PE=3 SV=1 9 361 2.0E-55
sp|A4J9B1|GLYA_DESRM Serine hydroxymethyltransferase OS=Desulfotomaculum reducens (strain MI-1) GN=glyA PE=3 SV=1 9 216 2.0E-55
sp|A4IXD7|GLYA_FRATW Serine hydroxymethyltransferase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=glyA PE=3 SV=1 14 355 3.0E-55
sp|Q5NFJ3|GLYA_FRATT Serine hydroxymethyltransferase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=glyA PE=3 SV=1 14 355 3.0E-55
sp|Q14GZ5|GLYA_FRAT1 Serine hydroxymethyltransferase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=glyA PE=3 SV=1 14 355 3.0E-55
sp|Q0BMN1|GLYA_FRATO Serine hydroxymethyltransferase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=glyA PE=3 SV=1 14 333 3.0E-55
sp|Q2A498|GLYA_FRATH Serine hydroxymethyltransferase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=glyA PE=3 SV=1 14 333 3.0E-55
sp|A7NB66|GLYA_FRATF Serine hydroxymethyltransferase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=glyA PE=3 SV=1 14 333 3.0E-55
sp|B0CL90|GLYA_BRUSI Serine hydroxymethyltransferase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=glyA PE=3 SV=1 9 361 3.0E-55
sp|B2SGE5|GLYA_FRATM Serine hydroxymethyltransferase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=glyA PE=3 SV=1 14 355 3.0E-55
sp|Q3IZN2|GLYA_RHOS4 Serine hydroxymethyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=glyA PE=3 SV=1 9 333 3.0E-55
sp|Q8A9S7|GLYA_BACTN Serine hydroxymethyltransferase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=glyA PE=3 SV=1 16 220 3.0E-55
sp|B2A3H6|GLYA_NATTJ Serine hydroxymethyltransferase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=glyA PE=3 SV=1 13 216 4.0E-55
sp|B8J189|GLYA_DESDA Serine hydroxymethyltransferase OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=glyA PE=3 SV=1 18 361 4.0E-55
sp|Q57DY5|GLYA_BRUAB Serine hydroxymethyltransferase OS=Brucella abortus biovar 1 (strain 9-941) GN=glyA PE=3 SV=1 9 361 4.0E-55
sp|Q2YN95|GLYA_BRUA2 Serine hydroxymethyltransferase OS=Brucella abortus (strain 2308) GN=glyA PE=3 SV=1 9 361 4.0E-55
sp|B2S513|GLYA_BRUA1 Serine hydroxymethyltransferase OS=Brucella abortus (strain S19) GN=glyA PE=3 SV=1 9 361 4.0E-55
sp|Q3KDV1|GLYA1_PSEPF Serine hydroxymethyltransferase 1 OS=Pseudomonas fluorescens (strain Pf0-1) GN=glyA1 PE=3 SV=1 14 216 4.0E-55
sp|C0RIA2|GLYA_BRUMB Serine hydroxymethyltransferase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=glyA PE=3 SV=1 9 361 4.0E-55
sp|Q64U78|GLYA_BACFR Serine hydroxymethyltransferase OS=Bacteroides fragilis (strain YCH46) GN=glyA PE=3 SV=1 16 220 4.0E-55
sp|Q5LD58|GLYA_BACFN Serine hydroxymethyltransferase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=glyA PE=3 SV=1 16 220 4.0E-55
sp|B0K631|GLYA_THEPX Serine hydroxymethyltransferase OS=Thermoanaerobacter sp. (strain X514) GN=glyA PE=3 SV=1 14 216 4.0E-55
sp|B0K742|GLYA_THEP3 Serine hydroxymethyltransferase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=glyA PE=3 SV=1 14 216 4.0E-55
sp|A5VPU7|GLYA_BRUO2 Serine hydroxymethyltransferase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=glyA PE=3 SV=1 9 361 5.0E-55
sp|B6IMT0|GLYA_RHOCS Serine hydroxymethyltransferase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=glyA PE=3 SV=1 1 390 5.0E-55
sp|B2KER5|GLYA_ELUMP Serine hydroxymethyltransferase OS=Elusimicrobium minutum (strain Pei191) GN=glyA PE=3 SV=1 10 216 6.0E-55
sp|Q5KUI2|GLYA_GEOKA Serine hydroxymethyltransferase OS=Geobacillus kaustophilus (strain HTA426) GN=glyA PE=3 SV=1 13 216 8.0E-55
sp|A6X1Y9|GLYA_OCHA4 Serine hydroxymethyltransferase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=glyA PE=3 SV=1 9 329 9.0E-55
sp|B7IQW9|GLYA_BACC2 Serine hydroxymethyltransferase OS=Bacillus cereus (strain G9842) GN=glyA PE=3 SV=1 13 361 9.0E-55
sp|P66804|GLYA_STAAW Serine hydroxymethyltransferase OS=Staphylococcus aureus (strain MW2) GN=glyA PE=3 SV=1 12 333 9.0E-55
sp|Q6G7J7|GLYA_STAAS Serine hydroxymethyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=glyA PE=3 SV=1 12 333 9.0E-55
sp|Q6GEW2|GLYA_STAAR Serine hydroxymethyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=glyA PE=3 SV=1 12 333 9.0E-55
sp|P99091|GLYA_STAAN Serine hydroxymethyltransferase OS=Staphylococcus aureus (strain N315) GN=glyA PE=1 SV=1 12 333 9.0E-55
sp|P66803|GLYA_STAAM Serine hydroxymethyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=glyA PE=3 SV=1 12 333 9.0E-55
sp|A6QIV7|GLYA_STAAE Serine hydroxymethyltransferase OS=Staphylococcus aureus (strain Newman) GN=glyA PE=3 SV=1 12 333 9.0E-55
sp|Q5HE87|GLYA_STAAC Serine hydroxymethyltransferase OS=Staphylococcus aureus (strain COL) GN=glyA PE=1 SV=1 12 333 9.0E-55
sp|A5IUQ8|GLYA_STAA9 Serine hydroxymethyltransferase OS=Staphylococcus aureus (strain JH9) GN=glyA PE=3 SV=1 12 333 9.0E-55
sp|Q2FWE5|GLYA_STAA8 Serine hydroxymethyltransferase OS=Staphylococcus aureus (strain NCTC 8325) GN=glyA PE=3 SV=1 12 333 9.0E-55
sp|A6U3J8|GLYA_STAA2 Serine hydroxymethyltransferase OS=Staphylococcus aureus (strain JH1) GN=glyA PE=3 SV=1 12 333 9.0E-55
sp|A7X4V7|GLYA_STAA1 Serine hydroxymethyltransferase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=glyA PE=3 SV=1 12 333 9.0E-55
sp|B2V398|GLYA_CLOBA Serine hydroxymethyltransferase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=glyA PE=3 SV=1 13 216 1.0E-54
sp|A8F595|GLYA_PSELT Serine hydroxymethyltransferase OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=glyA PE=3 SV=1 13 216 1.0E-54
sp|A1BE30|GLYA_CHLPD Serine hydroxymethyltransferase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=glyA PE=3 SV=1 14 220 1.0E-54
sp|P39148|GLYA_BACSU Serine hydroxymethyltransferase OS=Bacillus subtilis (strain 168) GN=glyA PE=1 SV=1 13 216 1.0E-54
sp|B2TN52|GLYA_CLOBB Serine hydroxymethyltransferase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=glyA PE=3 SV=1 13 216 1.0E-54
sp|B0TYH3|GLYA_FRAP2 Serine hydroxymethyltransferase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=glyA PE=3 SV=1 14 327 1.0E-54
sp|Q2YUJ1|GLYA_STAAB Serine hydroxymethyltransferase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=glyA PE=3 SV=1 12 333 2.0E-54
sp|Q6AM21|GLYA_DESPS Serine hydroxymethyltransferase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=glyA PE=3 SV=1 14 216 2.0E-54
sp|A6L5K3|GLYA_BACV8 Serine hydroxymethyltransferase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=glyA PE=3 SV=1 16 220 2.0E-54
sp|Q8EM73|GLYA_OCEIH Serine hydroxymethyltransferase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=glyA PE=3 SV=1 14 216 2.0E-54
sp|B9LKK8|GLYA_CHLSY Serine hydroxymethyltransferase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=glyA PE=3 SV=1 13 216 2.0E-54
sp|B0SMI6|GLYA_LEPBP Serine hydroxymethyltransferase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=glyA PE=3 SV=1 12 329 2.0E-54
sp|B0SEF8|GLYA_LEPBA Serine hydroxymethyltransferase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=glyA PE=3 SV=1 12 329 2.0E-54
sp|A6LUK9|GLYA_CLOB8 Serine hydroxymethyltransferase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=glyA PE=3 SV=1 13 333 2.0E-54
sp|A6Q478|GLYA_NITSB Serine hydroxymethyltransferase OS=Nitratiruptor sp. (strain SB155-2) GN=glyA PE=3 SV=1 14 216 2.0E-54
sp|B8G933|GLYA_CHLAD Serine hydroxymethyltransferase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=glyA PE=3 SV=1 13 216 2.0E-54
sp|A5FS31|GLYA_DEHMB Serine hydroxymethyltransferase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=glyA PE=3 SV=1 14 216 2.0E-54
sp|Q3ZZG3|GLYA_DEHMC Serine hydroxymethyltransferase OS=Dehalococcoides mccartyi (strain CBDB1) GN=glyA PE=3 SV=1 14 216 2.0E-54
sp|D3DKC4|GLYA_HYDTT Serine hydroxymethyltransferase OS=Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6) GN=glyA PE=1 SV=1 13 333 3.0E-54
sp|A9BIK8|GLYA_PETMO Serine hydroxymethyltransferase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=glyA PE=3 SV=1 14 216 3.0E-54
sp|A4ITJ9|GLYA_GEOTN Serine hydroxymethyltransferase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=glyA PE=3 SV=1 13 216 3.0E-54
sp|A4SFY3|GLYA_CHLPM Serine hydroxymethyltransferase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=glyA PE=3 SV=1 14 220 3.0E-54
sp|B7GTL3|GLYA_BIFLS Serine hydroxymethyltransferase OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=glyA PE=3 SV=1 10 350 3.0E-54
sp|Q8YGG7|GLYA_BRUME Serine hydroxymethyltransferase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=glyA PE=3 SV=2 9 329 6.0E-54
sp|Q5SI56|GLYA_THET8 Serine hydroxymethyltransferase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=glyA PE=1 SV=1 16 216 6.0E-54
sp|Q3Z9B9|GLYA_DEHM1 Serine hydroxymethyltransferase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=glyA PE=3 SV=1 14 216 7.0E-54
sp|A6Q7H8|GLYA_SULNB Serine hydroxymethyltransferase OS=Sulfurovum sp. (strain NBC37-1) GN=glyA PE=3 SV=1 10 216 7.0E-54
sp|Q6MS85|GLYA_MYCMS Serine hydroxymethyltransferase OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=glyA PE=3 SV=1 16 333 8.0E-54
sp|A9WI58|GLYA_CHLAA Serine hydroxymethyltransferase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=glyA PE=3 SV=1 13 216 8.0E-54
sp|Q46A52|GLYA_METBF Serine hydroxymethyltransferase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=glyA PE=1 SV=1 12 216 9.0E-54
sp|Q8DZM7|GLYA_STRA5 Serine hydroxymethyltransferase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=glyA PE=3 SV=1 13 390 9.0E-54
sp|Q3K122|GLYA_STRA1 Serine hydroxymethyltransferase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=glyA PE=3 SV=1 13 390 9.0E-54
sp|Q8E5C6|GLYA_STRA3 Serine hydroxymethyltransferase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=glyA PE=3 SV=1 13 333 1.0E-53
sp|Q2NIT8|GLYA_AYWBP Serine hydroxymethyltransferase OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=glyA PE=3 SV=1 14 216 1.0E-53
sp|Q72IH2|GLYA_THET2 Serine hydroxymethyltransferase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=glyA PE=3 SV=2 16 216 1.0E-53
sp|Q65DW5|GLYA_BACLD Serine hydroxymethyltransferase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=glyA PE=3 SV=1 13 216 1.0E-53
sp|Q30P60|GLYA2_SULDN Serine hydroxymethyltransferase 2 OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=glyA2 PE=3 SV=1 11 216 1.0E-53
sp|B2J2A2|GLYA_NOSP7 Serine hydroxymethyltransferase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=glyA PE=3 SV=1 11 216 2.0E-53
sp|A8FSQ9|GLYA_SHESH Serine hydroxymethyltransferase OS=Shewanella sediminis (strain HAW-EB3) GN=glyA PE=3 SV=1 18 330 2.0E-53
sp|A8YY80|GLYA_STAAT Serine hydroxymethyltransferase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=glyA PE=3 SV=1 12 333 2.0E-53
sp|Q2FF15|GLYA_STAA3 Serine hydroxymethyltransferase OS=Staphylococcus aureus (strain USA300) GN=glyA PE=3 SV=1 12 333 2.0E-53
sp|B1I6M4|GLYA_DESAP Serine hydroxymethyltransferase OS=Desulforudis audaxviator (strain MP104C) GN=glyA PE=3 SV=1 14 216 2.0E-53
sp|B1V975|GLYA_PHYAS Serine hydroxymethyltransferase OS=Phytoplasma australiense GN=glyA PE=3 SV=1 10 216 2.0E-53
sp|A7HJ69|GLYA_FERNB Serine hydroxymethyltransferase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=glyA PE=3 SV=1 14 216 2.0E-53
sp|Q01QZ0|GLYA_SOLUE Serine hydroxymethyltransferase OS=Solibacter usitatus (strain Ellin6076) GN=glyA PE=3 SV=1 6 216 3.0E-53
sp|A9NEA9|GLYA_ACHLI Serine hydroxymethyltransferase OS=Acholeplasma laidlawii (strain PG-8A) GN=glyA PE=3 SV=1 14 334 3.0E-53
sp|A1JKP3|GLYA_YERE8 Serine hydroxymethyltransferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=glyA PE=3 SV=1 18 330 3.0E-53
sp|B0CEI9|GLYA_ACAM1 Serine hydroxymethyltransferase OS=Acaryochloris marina (strain MBIC 11017) GN=glyA PE=3 SV=1 14 216 3.0E-53
sp|P9WGI7|GLYA2_MYCTU Serine hydroxymethyltransferase 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=glyA2 PE=1 SV=1 10 336 3.0E-53
sp|P9WGI6|GLYA2_MYCTO Serine hydroxymethyltransferase 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=glyA2 PE=3 SV=1 10 336 3.0E-53
sp|Q086C9|GLYA_SHEFN Serine hydroxymethyltransferase OS=Shewanella frigidimarina (strain NCIMB 400) GN=glyA PE=3 SV=1 18 332 4.0E-53
sp|B5YFZ0|GLYA_THEYD Serine hydroxymethyltransferase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=glyA PE=3 SV=1 14 216 4.0E-53
sp|A7Z9Q9|GLYA_BACMF Serine hydroxymethyltransferase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=glyA PE=3 SV=1 13 216 5.0E-53
sp|Q0SRQ2|GLYA_CLOPS Serine hydroxymethyltransferase OS=Clostridium perfringens (strain SM101 / Type A) GN=glyA PE=3 SV=1 13 216 5.0E-53
sp|B4RV95|GLYA_ALTMD Serine hydroxymethyltransferase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=glyA1 PE=3 SV=1 18 330 5.0E-53
sp|Q2LQM6|GLYA_SYNAS Serine hydroxymethyltransferase OS=Syntrophus aciditrophicus (strain SB) GN=glyA PE=3 SV=1 14 216 5.0E-53
sp|Q8YMW8|GLYA_NOSS1 Serine hydroxymethyltransferase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=glyA PE=3 SV=1 11 216 5.0E-53
sp|Q49Z60|GLYA_STAS1 Serine hydroxymethyltransferase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=glyA PE=3 SV=1 14 216 5.0E-53
sp|C6E348|GLYA_GEOSM Serine hydroxymethyltransferase OS=Geobacter sp. (strain M21) GN=glyA PE=3 SV=1 14 216 6.0E-53
sp|Q87RR2|GLYA1_VIBPA Serine hydroxymethyltransferase 1 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=glyA1 PE=3 SV=1 18 216 7.0E-53
sp|B5E8U0|GLYA_GEOBB Serine hydroxymethyltransferase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=glyA PE=3 SV=1 14 216 7.0E-53
sp|Q5WB66|GLYA_BACSK Serine hydroxymethyltransferase OS=Bacillus clausii (strain KSM-K16) GN=glyA PE=3 SV=1 13 216 7.0E-53
sp|A6LBG7|GLYA_PARD8 Serine hydroxymethyltransferase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=glyA PE=3 SV=1 16 220 7.0E-53
sp|Q04FR7|GLYA_OENOB Serine hydroxymethyltransferase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=glyA PE=3 SV=1 18 216 8.0E-53
sp|Q8XJ32|GLYA_CLOPE Serine hydroxymethyltransferase OS=Clostridium perfringens (strain 13 / Type A) GN=glyA PE=3 SV=1 13 216 9.0E-53
sp|Q0AUC3|GLYA_SYNWW Serine hydroxymethyltransferase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=glyA PE=3 SV=1 10 216 9.0E-53
sp|B3R0G5|GLYA_PHYMT Serine hydroxymethyltransferase OS=Phytoplasma mali (strain AT) GN=glyA PE=3 SV=1 18 216 9.0E-53
sp|B1YEH3|GLYA_EXIS2 Serine hydroxymethyltransferase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=glyA PE=3 SV=1 7 216 1.0E-52
sp|A0PZX4|GLYA_CLONN Serine hydroxymethyltransferase OS=Clostridium novyi (strain NT) GN=glyA PE=3 SV=1 13 216 1.0E-52
sp|Q0TP32|GLYA_CLOP1 Serine hydroxymethyltransferase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=glyA PE=3 SV=1 13 216 1.0E-52
sp|Q8CRN3|GLYA_STAES Serine hydroxymethyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=glyA PE=3 SV=1 12 216 2.0E-52
sp|Q5HMB0|GLYA_STAEQ Serine hydroxymethyltransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=glyA PE=3 SV=1 12 216 2.0E-52
sp|Q9KTG1|GLYA1_VIBCH Serine hydroxymethyltransferase 1 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=glyA1 PE=3 SV=2 18 216 2.0E-52
sp|Q48CP3|GLYA2_PSE14 Serine hydroxymethyltransferase 2 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=glyA2 PE=3 SV=1 13 216 2.0E-52
sp|A3QC57|GLYA_SHELP Serine hydroxymethyltransferase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=glyA PE=3 SV=1 18 216 2.0E-52
sp|Q7MN19|GLYA1_VIBVY Serine hydroxymethyltransferase 1 OS=Vibrio vulnificus (strain YJ016) GN=glyA1 PE=3 SV=1 18 216 2.0E-52
sp|Q8DFC9|GLYA1_VIBVU Serine hydroxymethyltransferase 1 OS=Vibrio vulnificus (strain CMCP6) GN=glyA1 PE=3 SV=1 18 216 2.0E-52
sp|Q4L7Z4|GLYA_STAHJ Serine hydroxymethyltransferase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=glyA PE=3 SV=1 12 216 3.0E-52
sp|B8GG35|GLYA_METPE Serine hydroxymethyltransferase OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=glyA PE=3 SV=1 12 216 3.0E-52
sp|P77962|GLYA_SYNY3 Serine hydroxymethyltransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=glyA PE=3 SV=1 14 216 3.0E-52
sp|Q6LU17|GLYA1_PHOPR Serine hydroxymethyltransferase 1 OS=Photobacterium profundum GN=glyA1 PE=3 SV=1 18 216 3.0E-52
sp|A6WR52|GLYA_SHEB8 Serine hydroxymethyltransferase OS=Shewanella baltica (strain OS185) GN=glyA PE=3 SV=1 18 216 3.0E-52
sp|B8CJM7|GLYA_SHEPW Serine hydroxymethyltransferase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=glyA PE=3 SV=1 18 216 4.0E-52
sp|A3D7D0|GLYA_SHEB5 Serine hydroxymethyltransferase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=glyA PE=3 SV=1 18 216 4.0E-52
sp|A0ALM4|GLYA_LISW6 Serine hydroxymethyltransferase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=glyA PE=3 SV=1 13 216 4.0E-52
sp|A9KSH6|GLYA_CLOPH Serine hydroxymethyltransferase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=glyA PE=3 SV=1 18 216 4.0E-52
sp|Q6YR37|GLYA_ONYPE Serine hydroxymethyltransferase OS=Onion yellows phytoplasma (strain OY-M) GN=glyA PE=3 SV=1 14 216 4.0E-52
sp|A9KYJ6|GLYA_SHEB9 Serine hydroxymethyltransferase OS=Shewanella baltica (strain OS195) GN=glyA PE=3 SV=1 18 216 4.0E-52
sp|Q24MM6|GLYA_DESHY Serine hydroxymethyltransferase OS=Desulfitobacterium hafniense (strain Y51) GN=glyA PE=3 SV=2 18 216 5.0E-52
sp|B3E1Z8|GLYA_GEOLS Serine hydroxymethyltransferase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=glyA PE=3 SV=1 14 216 5.0E-52
sp|Q3MBD8|GLYA_ANAVT Serine hydroxymethyltransferase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=glyA PE=3 SV=1 11 216 5.0E-52
sp|B0BSL4|GLYA_ACTPJ Serine hydroxymethyltransferase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=glyA PE=3 SV=1 13 216 5.0E-52
sp|B3H053|GLYA_ACTP7 Serine hydroxymethyltransferase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=glyA PE=3 SV=1 13 216 5.0E-52
sp|A3MYT3|GLYA_ACTP2 Serine hydroxymethyltransferase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=glyA PE=3 SV=1 13 216 5.0E-52
sp|Q2JT50|GLYA_SYNJA Serine hydroxymethyltransferase OS=Synechococcus sp. (strain JA-3-3Ab) GN=glyA PE=3 SV=1 12 216 5.0E-52
sp|B8E6W1|GLYA_SHEB2 Serine hydroxymethyltransferase OS=Shewanella baltica (strain OS223) GN=glyA PE=3 SV=1 18 216 6.0E-52
sp|Q6NI47|GLYA_CORDI Serine hydroxymethyltransferase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=glyA PE=3 SV=1 14 334 7.0E-52
sp|O66776|GLYA_AQUAE Serine hydroxymethyltransferase OS=Aquifex aeolicus (strain VF5) GN=glyA PE=3 SV=1 13 216 7.0E-52
sp|Q046F8|GLYA_LACGA Serine hydroxymethyltransferase OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=glyA PE=3 SV=1 19 216 7.0E-52
sp|Q0ABQ9|GLYA_ALKEH Serine hydroxymethyltransferase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=glyA PE=3 SV=1 18 216 7.0E-52
sp|Q9RYB2|GLYA_DEIRA Serine hydroxymethyltransferase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=glyA PE=3 SV=2 18 216 7.0E-52
sp|A7GV66|GLYA_BACCN Serine hydroxymethyltransferase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=glyA PE=3 SV=1 13 363 7.0E-52
sp|B0S1N3|GLYA_FINM2 Serine hydroxymethyltransferase OS=Finegoldia magna (strain ATCC 29328) GN=glyA PE=3 SV=1 13 216 7.0E-52
sp|B8FZ69|GLYA_DESHD Serine hydroxymethyltransferase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=glyA PE=3 SV=1 18 216 8.0E-52
sp|Q65T08|GLYA_MANSM Serine hydroxymethyltransferase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=glyA PE=3 SV=1 9 216 8.0E-52
sp|A1S4B5|GLYA_SHEAM Serine hydroxymethyltransferase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=glyA PE=3 SV=1 18 216 9.0E-52
sp|B0VLF5|GLYA_ACIBS Serine hydroxymethyltransferase OS=Acinetobacter baumannii (strain SDF) GN=glyA PE=3 SV=1 14 216 1.0E-51
sp|Q4K5R9|GLYA1_PSEF5 Serine hydroxymethyltransferase 1 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=glyA1 PE=3 SV=1 14 216 1.0E-51
sp|Q39V87|GLYA_GEOMG Serine hydroxymethyltransferase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=glyA PE=3 SV=1 14 216 1.0E-51
sp|B0VBB3|GLYA_ACIBY Serine hydroxymethyltransferase OS=Acinetobacter baumannii (strain AYE) GN=glyA PE=3 SV=1 14 216 1.0E-51
sp|A3M736|GLYA_ACIBT Serine hydroxymethyltransferase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=glyA PE=3 SV=2 14 216 1.0E-51
sp|B2HUY9|GLYA_ACIBC Serine hydroxymethyltransferase OS=Acinetobacter baumannii (strain ACICU) GN=glyA PE=3 SV=1 14 216 1.0E-51
sp|B7I2R7|GLYA_ACIB5 Serine hydroxymethyltransferase OS=Acinetobacter baumannii (strain AB0057) GN=glyA PE=3 SV=1 14 216 1.0E-51
sp|B7GZR6|GLYA_ACIB3 Serine hydroxymethyltransferase OS=Acinetobacter baumannii (strain AB307-0294) GN=glyA PE=3 SV=1 14 216 1.0E-51
sp|Q7W1I6|GLYA1_BORPA Serine hydroxymethyltransferase 1 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=glyA1 PE=3 SV=1 14 216 1.0E-51
sp|B0TJY5|GLYA_SHEHH Serine hydroxymethyltransferase OS=Shewanella halifaxensis (strain HAW-EB4) GN=glyA PE=3 SV=1 18 216 1.0E-51
sp|Q74CR5|GLYA_GEOSL Serine hydroxymethyltransferase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=glyA PE=3 SV=1 14 216 1.0E-51
sp|Q2JI36|GLYA_SYNJB Serine hydroxymethyltransferase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=glyA PE=3 SV=1 12 216 1.0E-51
sp|B8DBH0|GLYA_LISMH Serine hydroxymethyltransferase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=glyA PE=3 SV=1 13 216 1.0E-51
sp|Q71WN9|GLYA_LISMF Serine hydroxymethyltransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=glyA PE=3 SV=1 13 216 1.0E-51
sp|C1KYV6|GLYA_LISMC Serine hydroxymethyltransferase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=glyA PE=3 SV=1 13 216 1.0E-51
sp|Q8Y4B2|GLYA_LISMO Serine hydroxymethyltransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=glyA PE=3 SV=1 13 216 1.0E-51
sp|Q1WTR3|GLYA_LACS1 Serine hydroxymethyltransferase OS=Lactobacillus salivarius (strain UCC118) GN=glyA PE=3 SV=1 14 216 1.0E-51
sp|Q4ZM83|GLYA2_PSEU2 Serine hydroxymethyltransferase 2 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=glyA2 PE=3 SV=1 13 216 1.0E-51
sp|A7NIF2|GLYA_ROSCS Serine hydroxymethyltransferase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=glyA PE=3 SV=1 14 220 2.0E-51
sp|B7GMG4|GLYA_ANOFW Serine hydroxymethyltransferase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=glyA PE=3 SV=1 14 216 2.0E-51
sp|A4Y966|GLYA_SHEPC Serine hydroxymethyltransferase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=glyA PE=3 SV=1 18 216 2.0E-51
sp|A0LI16|GLYA_SYNFM Serine hydroxymethyltransferase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=glyA PE=3 SV=1 14 216 2.0E-51
sp|Q68W07|GLYA_RICTY Serine hydroxymethyltransferase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=glyA PE=3 SV=1 8 216 2.0E-51
sp|Q6LHN7|GLYA2_PHOPR Serine hydroxymethyltransferase 2 OS=Photobacterium profundum GN=glyA2 PE=3 SV=1 7 330 2.0E-51
sp|Q88AD1|GLYA1_PSESM Serine hydroxymethyltransferase 1 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=glyA1 PE=3 SV=1 13 216 3.0E-51
sp|Q8EBN8|GLYA_SHEON Serine hydroxymethyltransferase OS=Shewanella oneidensis (strain MR-1) GN=glyA PE=3 SV=1 18 216 3.0E-51
sp|Q0HL93|GLYA_SHESM Serine hydroxymethyltransferase OS=Shewanella sp. (strain MR-4) GN=glyA PE=3 SV=1 18 216 3.0E-51
sp|Q0HXJ6|GLYA_SHESR Serine hydroxymethyltransferase OS=Shewanella sp. (strain MR-7) GN=glyA PE=3 SV=1 18 216 3.0E-51
sp|A0KU60|GLYA_SHESA Serine hydroxymethyltransferase OS=Shewanella sp. (strain ANA-3) GN=glyA PE=3 SV=1 18 216 3.0E-51
sp|A5UQB7|GLYA_ROSS1 Serine hydroxymethyltransferase OS=Roseiflexus sp. (strain RS-1) GN=glyA PE=3 SV=1 14 220 3.0E-51
sp|Q2T437|GLYA2_BURTA Serine hydroxymethyltransferase 2 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=glyA2 PE=3 SV=1 9 329 3.0E-51
sp|Q7WPH6|GLYA1_BORBR Serine hydroxymethyltransferase 1 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=glyA1 PE=3 SV=1 14 216 4.0E-51
sp|C1CYT8|GLYA_DEIDV Serine hydroxymethyltransferase OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=glyA PE=3 SV=1 18 216 4.0E-51
sp|O85718|GLYA_ACIRA Serine hydroxymethyltransferase OS=Acinetobacter radioresistens GN=glyA PE=3 SV=1 18 216 4.0E-51
sp|Q81JY4|GLYA_BACAN Serine hydroxymethyltransferase OS=Bacillus anthracis GN=glyA PE=3 SV=1 13 216 4.0E-51
sp|C3LFJ0|GLYA_BACAC Serine hydroxymethyltransferase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=glyA PE=3 SV=1 13 216 4.0E-51
sp|C3P1G5|GLYA_BACAA Serine hydroxymethyltransferase OS=Bacillus anthracis (strain A0248) GN=glyA PE=3 SV=1 13 216 4.0E-51
sp|Q5N2P9|GLYA_SYNP6 Serine hydroxymethyltransferase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=glyA PE=3 SV=2 14 216 5.0E-51
sp|Q31RK5|GLYA_SYNE7 Serine hydroxymethyltransferase OS=Synechococcus elongatus (strain PCC 7942) GN=glyA PE=3 SV=1 14 216 5.0E-51
sp|Q03EK4|GLYA_PEDPA Serine hydroxymethyltransferase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=glyA PE=3 SV=1 16 216 5.0E-51
sp|Q927V4|GLYA_LISIN Serine hydroxymethyltransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=glyA PE=3 SV=1 13 216 5.0E-51
sp|C1DEQ3|GLYA_AZOVD Serine hydroxymethyltransferase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=glyA PE=3 SV=1 14 216 5.0E-51
sp|B7JYG9|GLYA_CYAP8 Serine hydroxymethyltransferase OS=Cyanothece sp. (strain PCC 8801) GN=glyA PE=3 SV=1 14 216 6.0E-51
sp|A9VSB4|GLYA_BACWK Serine hydroxymethyltransferase OS=Bacillus weihenstephanensis (strain KBAB4) GN=glyA PE=3 SV=1 13 216 6.0E-51
sp|Q3K6J0|GLYA2_PSEPF Serine hydroxymethyltransferase 2 OS=Pseudomonas fluorescens (strain Pf0-1) GN=glyA2 PE=3 SV=1 14 216 7.0E-51
sp|B9IRU8|GLYA_BACCQ Serine hydroxymethyltransferase OS=Bacillus cereus (strain Q1) GN=glyA PE=3 SV=1 13 216 7.0E-51
sp|Q72XD7|GLYA_BACC1 Serine hydroxymethyltransferase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=glyA PE=3 SV=1 13 216 7.0E-51
sp|A1RHD0|GLYA_SHESW Serine hydroxymethyltransferase OS=Shewanella sp. (strain W3-18-1) GN=glyA PE=3 SV=1 18 216 7.0E-51
sp|C1F0N9|GLYA_BACC3 Serine hydroxymethyltransferase OS=Bacillus cereus (strain 03BB102) GN=glyA PE=3 SV=1 13 216 7.0E-51
sp|B7JGP1|GLYA_BACC0 Serine hydroxymethyltransferase OS=Bacillus cereus (strain AH820) GN=glyA PE=3 SV=1 13 216 7.0E-51
sp|Q12Q48|GLYA_SHEDO Serine hydroxymethyltransferase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=glyA PE=3 SV=1 18 216 7.0E-51
sp|Q6FA66|GLYA_ACIAD Serine hydroxymethyltransferase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=glyA PE=3 SV=1 14 216 7.0E-51
sp|A8FIC1|GLYA_BACP2 Serine hydroxymethyltransferase OS=Bacillus pumilus (strain SAFR-032) GN=glyA PE=3 SV=1 13 216 7.0E-51
sp|Q88UT5|GLYA_LACPL Serine hydroxymethyltransferase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=glyA PE=3 SV=1 15 216 7.0E-51
sp|Q6HAW9|GLYA_BACHK Serine hydroxymethyltransferase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=glyA PE=3 SV=1 13 216 7.0E-51
sp|A0RLA3|GLYA_BACAH Serine hydroxymethyltransferase OS=Bacillus thuringiensis (strain Al Hakam) GN=glyA PE=3 SV=1 13 216 7.0E-51
sp|Q630T3|GLYA_BACCZ Serine hydroxymethyltransferase OS=Bacillus cereus (strain ZK / E33L) GN=glyA PE=3 SV=1 13 216 8.0E-51
sp|A8MGL7|GLYA_ALKOO Serine hydroxymethyltransferase OS=Alkaliphilus oremlandii (strain OhILAs) GN=glyA PE=3 SV=1 14 216 8.0E-51
sp|P57830|GLYA_PASMU Serine hydroxymethyltransferase OS=Pasteurella multocida (strain Pm70) GN=glyA PE=3 SV=1 11 216 8.0E-51
sp|Q63MV1|GLYA2_BURPS Serine hydroxymethyltransferase 2 OS=Burkholderia pseudomallei (strain K96243) GN=glyA2 PE=3 SV=2 9 329 8.0E-51
sp|Q3JGP5|GLYA2_BURP1 Serine hydroxymethyltransferase 2 OS=Burkholderia pseudomallei (strain 1710b) GN=glyA2 PE=1 SV=1 9 329 8.0E-51
sp|B7HY76|GLYA_BACC7 Serine hydroxymethyltransferase OS=Bacillus cereus (strain AH187) GN=glyA PE=3 SV=1 13 216 9.0E-51
sp|Q814V2|GLYA_BACCR Serine hydroxymethyltransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=glyA PE=3 SV=1 13 216 9.0E-51
sp|A8H1Q0|GLYA_SHEPA Serine hydroxymethyltransferase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=glyA PE=3 SV=1 18 216 9.0E-51
sp|Q88Q27|GLYA2_PSEPK Serine hydroxymethyltransferase 2 OS=Pseudomonas putida (strain KT2440) GN=glyA2 PE=3 SV=1 14 216 9.0E-51
sp|A4SJN4|GLYA_AERS4 Serine hydroxymethyltransferase OS=Aeromonas salmonicida (strain A449) GN=glyA PE=3 SV=1 18 216 9.0E-51
sp|B7HFL3|GLYA_BACC4 Serine hydroxymethyltransferase OS=Bacillus cereus (strain B4264) GN=glyA PE=3 SV=1 13 216 9.0E-51
sp|A2C090|GLYA_PROM1 Serine hydroxymethyltransferase OS=Prochlorococcus marinus (strain NATL1A) GN=glyA PE=3 SV=1 16 216 1.0E-50
sp|Q3AW18|GLYA_SYNS9 Serine hydroxymethyltransferase OS=Synechococcus sp. (strain CC9902) GN=glyA PE=3 SV=1 7 216 1.0E-50
sp|B5ELV3|GLYA_ACIF5 Serine hydroxymethyltransferase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=glyA PE=3 SV=1 18 216 1.0E-50
sp|B7J439|GLYA_ACIF2 Serine hydroxymethyltransferase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=glyA PE=3 SV=1 18 216 1.0E-50
sp|Q46HB6|GLYA_PROMT Serine hydroxymethyltransferase OS=Prochlorococcus marinus (strain NATL2A) GN=glyA PE=3 SV=1 16 216 1.0E-50
sp|A5FEF4|GLYA_FLAJ1 Serine hydroxymethyltransferase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=glyA PE=3 SV=1 18 220 1.0E-50
sp|A5CWI3|GLYA_VESOH Serine hydroxymethyltransferase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=glyA PE=3 SV=1 11 216 1.0E-50
sp|B5Y8G6|GLYA_COPPD Serine hydroxymethyltransferase OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=glyA PE=3 SV=1 13 216 2.0E-50
sp|A3DEB1|GLYA_CLOTH Serine hydroxymethyltransferase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=glyA PE=3 SV=1 14 216 2.0E-50
sp|B7KD38|GLYA_CYAP7 Serine hydroxymethyltransferase OS=Cyanothece sp. (strain PCC 7424) GN=glyA PE=3 SV=1 14 216 2.0E-50
sp|O08370|GLYA_RICPR Serine hydroxymethyltransferase OS=Rickettsia prowazekii (strain Madrid E) GN=glyA PE=3 SV=1 8 216 2.0E-50
sp|Q74LC1|GLYA_LACJO Serine hydroxymethyltransferase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=glyA PE=3 SV=1 19 216 2.0E-50
sp|A2BUN9|GLYA_PROM5 Serine hydroxymethyltransferase OS=Prochlorococcus marinus (strain MIT 9515) GN=glyA PE=3 SV=1 13 216 2.0E-50
sp|B2V9M1|GLYA_SULSY Serine hydroxymethyltransferase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=glyA PE=3 SV=1 13 390 2.0E-50
sp|C1F3Q7|GLYA_ACIC5 Serine hydroxymethyltransferase OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=glyA PE=3 SV=1 10 216 2.0E-50
sp|A5UDI4|GLYA_HAEIE Serine hydroxymethyltransferase OS=Haemophilus influenzae (strain PittEE) GN=glyA PE=3 SV=1 18 216 2.0E-50
sp|Q62DI5|GLYA2_BURMA Serine hydroxymethyltransferase 2 OS=Burkholderia mallei (strain ATCC 23344) GN=glyA2 PE=3 SV=1 9 329 2.0E-50
sp|A9GPH2|GLYA_SORC5 Serine hydroxymethyltransferase OS=Sorangium cellulosum (strain So ce56) GN=glyA PE=3 SV=1 1 216 2.0E-50
sp|A5UI33|GLYA_HAEIG Serine hydroxymethyltransferase OS=Haemophilus influenzae (strain PittGG) GN=glyA PE=3 SV=1 18 216 2.0E-50
sp|P43844|GLYA_HAEIN Serine hydroxymethyltransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=glyA PE=3 SV=1 18 216 2.0E-50
sp|Q4QM19|GLYA_HAEI8 Serine hydroxymethyltransferase OS=Haemophilus influenzae (strain 86-028NP) GN=glyA PE=3 SV=1 18 216 2.0E-50
sp|Q7ND67|GLYA_GLOVI Serine hydroxymethyltransferase OS=Gloeobacter violaceus (strain PCC 7421) GN=glyA PE=3 SV=1 14 216 3.0E-50
sp|B9DS48|GLYA_STRU0 Serine hydroxymethyltransferase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=glyA PE=3 SV=1 13 216 3.0E-50
sp|A0KNH4|GLYA_AERHH Serine hydroxymethyltransferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=glyA PE=3 SV=1 18 216 3.0E-50
sp|B6EHX0|GLYA_ALISL Serine hydroxymethyltransferase OS=Aliivibrio salmonicida (strain LFI1238) GN=glyA PE=3 SV=1 18 216 3.0E-50
sp|Q831F9|GLYA_ENTFA Serine hydroxymethyltransferase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=glyA PE=3 SV=1 18 216 4.0E-50
sp|Q47MD6|GLYA_THEFY Serine hydroxymethyltransferase OS=Thermobifida fusca (strain YX) GN=glyA PE=3 SV=1 3 216 4.0E-50
sp|Q21NP8|GLYA_SACD2 Serine hydroxymethyltransferase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=glyA PE=3 SV=1 14 216 5.0E-50
sp|Q4K4P6|GLYA2_PSEF5 Serine hydroxymethyltransferase 2 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=glyA2 PE=3 SV=1 13 216 5.0E-50
sp|Q9KMP4|GLYA2_VIBCH Serine hydroxymethyltransferase 2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=glyA2 PE=3 SV=1 7 334 6.0E-50
sp|B2FNK2|GLYA_STRMK Serine hydroxymethyltransferase OS=Stenotrophomonas maltophilia (strain K279a) GN=glyA PE=3 SV=1 14 298 6.0E-50
sp|A5GIG4|GLYA_SYNPW Serine hydroxymethyltransferase OS=Synechococcus sp. (strain WH7803) GN=glyA PE=3 SV=1 3 216 6.0E-50
sp|Q601P7|GLYA_MYCH2 Serine hydroxymethyltransferase OS=Mycoplasma hyopneumoniae (strain 232) GN=glyA PE=3 SV=1 18 216 7.0E-50
sp|Q38WJ7|GLYA_LACSS Serine hydroxymethyltransferase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=glyA PE=3 SV=1 14 216 7.0E-50
sp|Q3II23|GLYA_PSEHT Serine hydroxymethyltransferase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=glyA PE=3 SV=1 11 361 7.0E-50
sp|A4VI36|GLYA_PSEU5 Serine hydroxymethyltransferase OS=Pseudomonas stutzeri (strain A1501) GN=glyA PE=3 SV=1 14 216 7.0E-50
sp|Q67N41|GLYA_SYMTH Serine hydroxymethyltransferase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=glyA PE=3 SV=1 14 216 8.0E-50
sp|Q6F211|GLYA_MESFL Serine hydroxymethyltransferase OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=glyA PE=3 SV=1 21 333 8.0E-50
sp|B3CM26|GLYA_WOLPP Serine hydroxymethyltransferase OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=glyA PE=3 SV=1 13 333 8.0E-50
sp|Q8D7G5|GLYA2_VIBVU Serine hydroxymethyltransferase 2 OS=Vibrio vulnificus (strain CMCP6) GN=glyA2 PE=3 SV=1 7 333 8.0E-50
sp|Q7VFL1|GLYA_HELHP Serine hydroxymethyltransferase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=glyA PE=3 SV=1 14 216 8.0E-50
sp|Q39A26|GLYA1_BURL3 Serine hydroxymethyltransferase 1 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=glyA1 PE=3 SV=1 3 329 9.0E-50
sp|Q1QE01|GLYA_PSYCK Serine hydroxymethyltransferase OS=Psychrobacter cryohalolentis (strain K5) GN=glyA PE=3 SV=1 18 216 1.0E-49
sp|Q87WC1|GLYA2_PSESM Serine hydroxymethyltransferase 2 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=glyA2 PE=3 SV=1 14 216 1.0E-49
sp|C0QQE4|GLYA_PERMH Serine hydroxymethyltransferase OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=glyA PE=3 SV=1 13 390 1.0E-49
sp|Q98A81|GLYA2_RHILO Serine hydroxymethyltransferase 2 OS=Rhizobium loti (strain MAFF303099) GN=glyA2 PE=3 SV=1 14 216 1.0E-49
sp|B8I2N8|GLYA_CLOCE Serine hydroxymethyltransferase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=glyA PE=3 SV=1 14 216 1.0E-49
sp|A6VXM6|GLYA_MARMS Serine hydroxymethyltransferase OS=Marinomonas sp. (strain MWYL1) GN=glyA PE=3 SV=1 7 216 1.0E-49
sp|A3PAX9|GLYA_PROM0 Serine hydroxymethyltransferase OS=Prochlorococcus marinus (strain MIT 9301) GN=glyA PE=3 SV=1 13 216 1.0E-49
sp|A6VP23|GLYA_ACTSZ Serine hydroxymethyltransferase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=glyA PE=3 SV=1 18 216 1.0E-49
sp|A9BDM9|GLYA_PROM4 Serine hydroxymethyltransferase OS=Prochlorococcus marinus (strain MIT 9211) GN=glyA PE=3 SV=1 10 216 1.0E-49
sp|Q31CS4|GLYA_PROM9 Serine hydroxymethyltransferase OS=Prochlorococcus marinus (strain MIT 9312) GN=glyA PE=3 SV=1 13 216 1.0E-49
sp|C0R4C7|GLYA_WOLWR Serine hydroxymethyltransferase OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=glyA PE=3 SV=1 14 216 1.0E-49
sp|Q0IDD8|GLYA_SYNS3 Serine hydroxymethyltransferase OS=Synechococcus sp. (strain CC9311) GN=glyA PE=3 SV=1 10 216 2.0E-49
sp|Q2SFI7|GLYA1_HAHCH Serine hydroxymethyltransferase 1 OS=Hahella chejuensis (strain KCTC 2396) GN=glyA1 PE=3 SV=1 18 333 2.0E-49
sp|P24060|GLYA_BRADU Serine hydroxymethyltransferase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=glyA PE=3 SV=2 9 216 2.0E-49
sp|B4EZV5|GLYA_PROMH Serine hydroxymethyltransferase OS=Proteus mirabilis (strain HI4320) GN=glyA PE=3 SV=1 18 319 2.0E-49
sp|A4VUM9|GLYA_STRSY Serine hydroxymethyltransferase OS=Streptococcus suis (strain 05ZYH33) GN=glyA PE=3 SV=1 18 216 2.0E-49
sp|A4W0W9|GLYA_STRS2 Serine hydroxymethyltransferase OS=Streptococcus suis (strain 98HAH33) GN=glyA PE=3 SV=1 18 216 2.0E-49
sp|Q481S6|GLYA2_COLP3 Serine hydroxymethyltransferase 2 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=glyA2 PE=3 SV=1 18 216 2.0E-49
sp|Q31FS6|GLYA_THICR Serine hydroxymethyltransferase OS=Thiomicrospira crunogena (strain XCL-2) GN=glyA PE=3 SV=1 18 216 2.0E-49
sp|Q32D21|GLYA_SHIDS Serine hydroxymethyltransferase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=glyA PE=3 SV=1 18 216 2.0E-49
sp|Q88R12|GLYA1_PSEPK Serine hydroxymethyltransferase 1 OS=Pseudomonas putida (strain KT2440) GN=glyA1 PE=3 SV=1 13 216 2.0E-49
sp|Q0VMH4|GLYA_ALCBS Serine hydroxymethyltransferase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=glyA PE=3 SV=1 11 216 2.0E-49
sp|Q7MAR0|GLYA_WOLSU Serine hydroxymethyltransferase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=glyA PE=3 SV=1 14 216 2.0E-49
sp|Q4A8E1|GLYA_MYCH7 Serine hydroxymethyltransferase OS=Mycoplasma hyopneumoniae (strain 7448) GN=glyA PE=3 SV=1 18 216 2.0E-49
sp|Q9I138|GLYA2_PSEAE Serine hydroxymethyltransferase 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=glyA2 PE=3 SV=1 9 216 2.0E-49
sp|Q3A4L9|GLYA_PELCD Serine hydroxymethyltransferase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=glyA PE=3 SV=1 10 216 2.0E-49
sp|Q3K5K9|GLYA3_PSEPF Serine hydroxymethyltransferase 3 OS=Pseudomonas fluorescens (strain Pf0-1) GN=glyA3 PE=3 SV=1 13 216 2.0E-49
sp|Q2GHF1|GLYA_EHRCR Serine hydroxymethyltransferase OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=glyA PE=3 SV=1 9 216 3.0E-49
sp|B5FBF0|GLYA_VIBFM Serine hydroxymethyltransferase OS=Vibrio fischeri (strain MJ11) GN=glyA PE=3 SV=1 18 216 3.0E-49
sp|Q5E706|GLYA_VIBF1 Serine hydroxymethyltransferase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=glyA PE=3 SV=1 18 216 3.0E-49
sp|P0A827|GLYA_SHIFL Serine hydroxymethyltransferase OS=Shigella flexneri GN=glyA PE=3 SV=1 18 216 3.0E-49
sp|Q0T1W9|GLYA_SHIF8 Serine hydroxymethyltransferase OS=Shigella flexneri serotype 5b (strain 8401) GN=glyA PE=3 SV=1 18 216 3.0E-49
sp|Q31XT6|GLYA_SHIBS Serine hydroxymethyltransferase OS=Shigella boydii serotype 4 (strain Sb227) GN=glyA PE=3 SV=1 18 216 3.0E-49
sp|B2TXW4|GLYA_SHIB3 Serine hydroxymethyltransferase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=glyA PE=3 SV=1 18 216 3.0E-49
sp|Q1R8I4|GLYA_ECOUT Serine hydroxymethyltransferase OS=Escherichia coli (strain UTI89 / UPEC) GN=glyA PE=3 SV=2 18 216 3.0E-49
sp|B1LNK7|GLYA_ECOSM Serine hydroxymethyltransferase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=glyA PE=3 SV=1 18 216 3.0E-49
sp|B6I5C4|GLYA_ECOSE Serine hydroxymethyltransferase OS=Escherichia coli (strain SE11) GN=glyA PE=3 SV=1 18 216 3.0E-49
sp|P0A825|GLYA_ECOLI Serine hydroxymethyltransferase OS=Escherichia coli (strain K12) GN=glyA PE=1 SV=1 18 216 3.0E-49
sp|B1IVS6|GLYA_ECOLC Serine hydroxymethyltransferase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=glyA PE=3 SV=1 18 216 3.0E-49
sp|P0A826|GLYA_ECOL6 Serine hydroxymethyltransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=glyA PE=3 SV=1 18 216 3.0E-49
sp|Q0TET8|GLYA_ECOL5 Serine hydroxymethyltransferase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=glyA PE=3 SV=1 18 216 3.0E-49
sp|A1AE82|GLYA_ECOK1 Serine hydroxymethyltransferase OS=Escherichia coli O1:K1 / APEC GN=glyA PE=3 SV=2 18 216 3.0E-49
sp|A8A359|GLYA_ECOHS Serine hydroxymethyltransferase OS=Escherichia coli O9:H4 (strain HS) GN=glyA PE=3 SV=1 18 216 3.0E-49
sp|B1XB26|GLYA_ECODH Serine hydroxymethyltransferase OS=Escherichia coli (strain K12 / DH10B) GN=glyA PE=3 SV=1 18 216 3.0E-49
sp|C4ZXC6|GLYA_ECOBW Serine hydroxymethyltransferase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=glyA PE=3 SV=1 18 216 3.0E-49
sp|B7M8A7|GLYA_ECO8A Serine hydroxymethyltransferase OS=Escherichia coli O8 (strain IAI1) GN=glyA PE=3 SV=1 18 216 3.0E-49
sp|B7MYI0|GLYA_ECO81 Serine hydroxymethyltransferase OS=Escherichia coli O81 (strain ED1a) GN=glyA PE=3 SV=1 18 216 3.0E-49
sp|B7NRK2|GLYA_ECO7I Serine hydroxymethyltransferase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=glyA PE=3 SV=1 18 216 3.0E-49
sp|B7LDE3|GLYA_ECO55 Serine hydroxymethyltransferase OS=Escherichia coli (strain 55989 / EAEC) GN=glyA PE=3 SV=1 18 216 3.0E-49
sp|B7MIN5|GLYA_ECO45 Serine hydroxymethyltransferase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=glyA PE=3 SV=1 18 216 3.0E-49
sp|B7UGZ1|GLYA_ECO27 Serine hydroxymethyltransferase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=glyA PE=3 SV=1 18 216 3.0E-49
sp|A7ZPZ4|GLYA_ECO24 Serine hydroxymethyltransferase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=glyA PE=3 SV=1 18 216 3.0E-49
sp|Q3YRD1|GLYA_EHRCJ Serine hydroxymethyltransferase OS=Ehrlichia canis (strain Jake) GN=glyA PE=3 SV=1 9 216 3.0E-49
sp|Q111H1|GLYA_TRIEI Serine hydroxymethyltransferase OS=Trichodesmium erythraeum (strain IMS101) GN=glyA PE=3 SV=1 14 216 3.0E-49
sp|Q3YZ04|GLYA_SHISS Serine hydroxymethyltransferase OS=Shigella sonnei (strain Ss046) GN=glyA PE=3 SV=1 18 216 3.0E-49
sp|Q607U4|GLYA_METCA Serine hydroxymethyltransferase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=glyA PE=3 SV=1 18 216 3.0E-49
sp|Q3J9K8|GLYA_NITOC Serine hydroxymethyltransferase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=glyA PE=3 SV=1 25 216 3.0E-49
sp|B5Z123|GLYA_ECO5E Serine hydroxymethyltransferase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=glyA PE=3 SV=1 18 216 3.0E-49
sp|Q8XA55|GLYA_ECO57 Serine hydroxymethyltransferase OS=Escherichia coli O157:H7 GN=glyA PE=3 SV=1 18 216 3.0E-49
sp|Q0SMQ5|GLYA_BORAP Serine hydroxymethyltransferase OS=Borrelia afzelii (strain PKo) GN=glyA PE=3 SV=1 18 216 3.0E-49
sp|A1TYW8|GLYA_MARHV Serine hydroxymethyltransferase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=glyA PE=3 SV=1 18 216 3.0E-49
sp|Q214H7|GLYA_RHOPB Serine hydroxymethyltransferase OS=Rhodopseudomonas palustris (strain BisB18) GN=glyA PE=3 SV=1 9 216 3.0E-49
sp|Q7VDS8|GLYA_PROMA Serine hydroxymethyltransferase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=glyA PE=3 SV=1 10 216 3.0E-49
sp|B2IJJ3|GLYA_BEII9 Serine hydroxymethyltransferase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=glyA PE=3 SV=1 9 216 3.0E-49
sp|Q8U7Y5|GLYA2_AGRFC Serine hydroxymethyltransferase 2 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=glyA2 PE=3 SV=1 12 216 3.0E-49
sp|Q4FUZ8|GLYA_PSYA2 Serine hydroxymethyltransferase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=glyA PE=3 SV=1 18 216 3.0E-49
sp|Q5QXT4|GLYA_IDILO Serine hydroxymethyltransferase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=glyA PE=3 SV=1 18 216 3.0E-49
sp|A5EKI3|GLYA_BRASB Serine hydroxymethyltransferase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=glyA PE=3 SV=1 9 216 3.0E-49
sp|Q48DU7|GLYA1_PSE14 Serine hydroxymethyltransferase 1 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=glyA1 PE=3 SV=1 14 216 4.0E-49
sp|Q2G646|GLYA_NOVAD Serine hydroxymethyltransferase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=glyA PE=3 SV=1 9 216 4.0E-49
sp|A4YW97|GLYA_BRASO Serine hydroxymethyltransferase OS=Bradyrhizobium sp. (strain ORS278) GN=glyA PE=3 SV=1 9 216 4.0E-49
sp|Q15WB3|GLYA_PSEA6 Serine hydroxymethyltransferase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=glyA PE=3 SV=1 18 216 4.0E-49
sp|Q4AAB2|GLYA_MYCHJ Serine hydroxymethyltransferase OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=glyA PE=3 SV=1 18 216 4.0E-49
sp|Q1J1W0|GLYA_DEIGD Serine hydroxymethyltransferase OS=Deinococcus geothermalis (strain DSM 11300) GN=glyA PE=3 SV=1 18 216 4.0E-49
sp|Q4ZNH2|GLYA1_PSEU2 Serine hydroxymethyltransferase 1 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=glyA1 PE=3 SV=1 14 216 4.0E-49
sp|Q9HVI7|GLYA3_PSEAE Serine hydroxymethyltransferase 3 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=glyA2 PE=3 SV=1 14 216 5.0E-49
sp|B4SJB0|GLYA_STRM5 Serine hydroxymethyltransferase OS=Stenotrophomonas maltophilia (strain R551-3) GN=glyA PE=3 SV=1 14 298 5.0E-49
sp|Q73GC3|GLYA_WOLPM Serine hydroxymethyltransferase OS=Wolbachia pipientis wMel GN=glyA PE=3 SV=1 14 216 5.0E-49
sp|Q5HAJ7|GLYA_EHRRW Serine hydroxymethyltransferase OS=Ehrlichia ruminantium (strain Welgevonden) GN=glyA PE=3 SV=1 14 216 5.0E-49
sp|Q5FG30|GLYA_EHRRG Serine hydroxymethyltransferase OS=Ehrlichia ruminantium (strain Gardel) GN=glyA PE=3 SV=1 14 216 5.0E-49
sp|B2VI25|GLYA_ERWT9 Serine hydroxymethyltransferase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=glyA PE=3 SV=1 18 216 5.0E-49
sp|B3WDL0|GLYA_LACCB Serine hydroxymethyltransferase OS=Lactobacillus casei (strain BL23) GN=glyA PE=3 SV=1 18 216 6.0E-49
sp|Q03A26|GLYA_LACC3 Serine hydroxymethyltransferase OS=Lactobacillus casei (strain ATCC 334) GN=glyA PE=3 SV=1 18 216 6.0E-49
sp|B7J2G3|GLYA_BORBZ Serine hydroxymethyltransferase OS=Borrelia burgdorferi (strain ZS7) GN=glyA PE=3 SV=1 18 216 6.0E-49
sp|O51547|GLYA_BORBU Serine hydroxymethyltransferase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=glyA PE=3 SV=1 18 216 6.0E-49
sp|P34894|GLYA_AGGAC Serine hydroxymethyltransferase OS=Aggregatibacter actinomycetemcomitans GN=glyA PE=3 SV=1 11 216 6.0E-49
sp|B5YDB7|GLYA_DICT6 Serine hydroxymethyltransferase OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=glyA PE=3 SV=1 13 334 7.0E-49
sp|B8D981|GLYA_BUCA5 Serine hydroxymethyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=glyA PE=3 SV=1 14 216 7.0E-49
sp|A0B8J6|GLYA_METTP Serine hydroxymethyltransferase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=glyA PE=3 SV=1 14 216 7.0E-49
sp|Q660S1|GLYA_BORBP Serine hydroxymethyltransferase OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=glyA PE=3 SV=1 18 216 7.0E-49
sp|C0PYJ5|GLYA_SALPC Serine hydroxymethyltransferase OS=Salmonella paratyphi C (strain RKS4594) GN=glyA PE=3 SV=1 18 216 7.0E-49
sp|B1HM45|GLYA_LYSSC Serine hydroxymethyltransferase OS=Lysinibacillus sphaericus (strain C3-41) GN=glyA PE=3 SV=1 18 216 8.0E-49
sp|P0A2E1|GLYA_SALTY Serine hydroxymethyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=glyA PE=1 SV=1 18 216 8.0E-49
sp|B5BAV4|GLYA_SALPK Serine hydroxymethyltransferase OS=Salmonella paratyphi A (strain AKU_12601) GN=glyA PE=3 SV=1 18 216 8.0E-49
sp|A9N1W0|GLYA_SALPB Serine hydroxymethyltransferase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=glyA PE=3 SV=1 18 216 8.0E-49
sp|Q5PII3|GLYA_SALPA Serine hydroxymethyltransferase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=glyA PE=3 SV=1 18 216 8.0E-49
sp|B4T1D1|GLYA_SALNS Serine hydroxymethyltransferase OS=Salmonella newport (strain SL254) GN=glyA PE=3 SV=1 18 216 8.0E-49
sp|B4TDC8|GLYA_SALHS Serine hydroxymethyltransferase OS=Salmonella heidelberg (strain SL476) GN=glyA PE=3 SV=1 18 216 8.0E-49
sp|Q57LF7|GLYA_SALCH Serine hydroxymethyltransferase OS=Salmonella choleraesuis (strain SC-B67) GN=glyA PE=3 SV=1 18 216 8.0E-49
sp|B5F1D2|GLYA_SALA4 Serine hydroxymethyltransferase OS=Salmonella agona (strain SL483) GN=glyA PE=3 SV=1 18 216 8.0E-49
sp|P0A2E2|GLYA1_SALTI Serine hydroxymethyltransferase 1 OS=Salmonella typhi GN=glyA1 PE=1 SV=1 18 216 8.0E-49
sp|B7N6D8|GLYA_ECOLU Serine hydroxymethyltransferase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=glyA PE=3 SV=1 18 216 8.0E-49
sp|Q8XTQ1|GLYA2_RALSO Serine hydroxymethyltransferase 2 OS=Ralstonia solanacearum (strain GMI1000) GN=glyA2 PE=3 SV=1 3 329 9.0E-49
sp|B4TRY8|GLYA_SALSV Serine hydroxymethyltransferase OS=Salmonella schwarzengrund (strain CVM19633) GN=glyA PE=3 SV=1 18 216 9.0E-49
sp|C4LAE6|GLYA_TOLAT Serine hydroxymethyltransferase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=glyA PE=3 SV=1 18 216 9.0E-49
sp|Q47WY2|GLYA4_COLP3 Serine hydroxymethyltransferase 4 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=glyA4 PE=3 SV=1 18 216 9.0E-49
sp|Q9HTE9|GLYA1_PSEAE Serine hydroxymethyltransferase 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=glyA1 PE=3 SV=1 18 216 9.0E-49
sp|Q3AN03|GLYA_SYNSC Serine hydroxymethyltransferase OS=Synechococcus sp. (strain CC9605) GN=glyA PE=3 SV=1 10 216 1.0E-48
sp|Q4UK96|GLYA_RICFE Serine hydroxymethyltransferase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=glyA PE=3 SV=1 8 216 1.0E-48
sp|Q2W4T2|GLYA_MAGSA Serine hydroxymethyltransferase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=glyA PE=3 SV=1 14 216 1.0E-48
sp|Q057P9|GLYA_BUCCC Serine hydroxymethyltransferase OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=glyA PE=3 SV=1 9 216 1.0E-48
sp|A8AD38|GLYA_CITK8 Serine hydroxymethyltransferase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=glyA PE=3 SV=2 18 216 1.0E-48
sp|Q30R29|GLYA1_SULDN Serine hydroxymethyltransferase 1 OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=glyA1 PE=3 SV=1 12 216 1.0E-48
sp|B2GM31|GLYA_KOCRD Serine hydroxymethyltransferase OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=glyA PE=3 SV=1 14 216 1.0E-48
sp|A2BP57|GLYA_PROMS Serine hydroxymethyltransferase OS=Prochlorococcus marinus (strain AS9601) GN=glyA PE=3 SV=1 13 216 1.0E-48
sp|Q6D246|GLYA1_PECAS Serine hydroxymethyltransferase 1 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=glyA1 PE=3 SV=1 18 216 1.0E-48
sp|B3QUG2|GLYA_CHLT3 Serine hydroxymethyltransferase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=glyA PE=3 SV=1 14 220 1.0E-48
sp|Q2YD58|GLYA_NITMU Serine hydroxymethyltransferase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=glyA PE=3 SV=1 9 216 1.0E-48
sp|Q5V3D7|GLYA_HALMA Serine hydroxymethyltransferase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=glyA PE=3 SV=1 14 216 2.0E-48
sp|Q10104|GLYM_SCHPO Serine hydroxymethyltransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shm2 PE=3 SV=2 209 391 3.0E-47
sp|P50433|GLYM_SOLTU Serine hydroxymethyltransferase, mitochondrial OS=Solanum tuberosum PE=2 SV=1 211 389 1.0E-46
sp|P34899|GLYM_PEA Serine hydroxymethyltransferase, mitochondrial OS=Pisum sativum PE=1 SV=1 211 389 6.0E-46
sp|Q9SZJ5|GLYM1_ARATH Serine hydroxymethyltransferase 1, mitochondrial OS=Arabidopsis thaliana GN=SHM1 PE=1 SV=1 211 389 8.0E-46
sp|O13972|GLYD_SCHPO Probable serine hydroxymethyltransferase, cytosolic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24C9.12c PE=3 SV=1 209 390 7.0E-45
sp|Q94C74|GLYM2_ARATH Serine hydroxymethyltransferase 2, mitochondrial OS=Arabidopsis thaliana GN=SHM2 PE=2 SV=2 211 389 9.0E-44
sp|P34898|GLYC_NEUCR Serine hydroxymethyltransferase, cytosolic OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=for PE=3 SV=2 209 391 7.0E-43
sp|P49358|GLYM2_FLAPR Serine hydroxymethyltransferase 2, mitochondrial OS=Flaveria pringlei PE=2 SV=1 211 389 1.0E-42
sp|P49357|GLYM1_FLAPR Serine hydroxymethyltransferase 1, mitochondrial OS=Flaveria pringlei PE=2 SV=1 211 389 4.0E-42
sp|Q94JQ3|GLYP3_ARATH Serine hydroxymethyltransferase 3, chloroplastic OS=Arabidopsis thaliana GN=SHM3 PE=1 SV=2 211 391 5.0E-42
sp|P34897|GLYM_HUMAN Serine hydroxymethyltransferase, mitochondrial OS=Homo sapiens GN=SHMT2 PE=1 SV=3 209 391 6.0E-42
sp|Q758F0|GLYM_ASHGO Serine hydroxymethyltransferase, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SHM1 PE=3 SV=1 209 391 9.0E-42
sp|P35623|GLYC_SHEEP Serine hydroxymethyltransferase, cytosolic OS=Ovis aries GN=SHMT1 PE=1 SV=3 211 391 1.0E-41
sp|Q5E9P9|GLYC_BOVIN Serine hydroxymethyltransferase, cytosolic OS=Bos taurus GN=SHMT1 PE=2 SV=3 211 391 2.0E-41
sp|P14519|GLYM_RABIT Serine hydroxymethyltransferase, mitochondrial OS=Oryctolagus cuniculus GN=SHMT2 PE=1 SV=2 209 391 6.0E-41
sp|Q3SZ20|GLYM_BOVIN Serine hydroxymethyltransferase, mitochondrial OS=Bos taurus GN=SHMT2 PE=2 SV=1 209 391 5.0E-40
sp|P07511|GLYC_RABIT Serine hydroxymethyltransferase, cytosolic OS=Oryctolagus cuniculus GN=SHMT1 PE=1 SV=2 211 391 1.0E-39
sp|P37292|GLYM_YEAST Serine hydroxymethyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SHM1 PE=1 SV=2 209 393 2.0E-39
sp|P34896|GLYC_HUMAN Serine hydroxymethyltransferase, cytosolic OS=Homo sapiens GN=SHMT1 PE=1 SV=1 211 391 2.0E-39
sp|P50431|GLYC_MOUSE Serine hydroxymethyltransferase, cytosolic OS=Mus musculus GN=Shmt1 PE=1 SV=3 211 391 5.0E-39
sp|Q6FQ44|GLYM_CANGA Serine hydroxymethyltransferase, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SHM1 PE=3 SV=1 209 391 7.0E-39
sp|Q6CLQ5|GLYM_KLULA Serine hydroxymethyltransferase, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SHM1 PE=3 SV=1 209 391 8.0E-39
sp|Q5RFK5|GLYC_PONAB Serine hydroxymethyltransferase, cytosolic OS=Pongo abelii GN=SHMT1 PE=2 SV=1 211 391 2.0E-38
sp|O13425|GLYM_CANAX Serine hydroxymethyltransferase, mitochondrial OS=Candida albicans GN=SHM1 PE=3 SV=1 209 391 6.0E-38
sp|Q75BQ6|GLYC_ASHGO Serine hydroxymethyltransferase, cytosolic OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SHM2 PE=3 SV=2 209 391 3.0E-37
sp|Q6FUP6|GLYC_CANGA Serine hydroxymethyltransferase, cytosolic OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SHM2 PE=3 SV=1 209 390 2.0E-36
sp|P37291|GLYC_YEAST Serine hydroxymethyltransferase, cytosolic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SHM2 PE=1 SV=2 209 390 3.0E-36
sp|O13426|GLYC_CANAL Serine hydroxymethyltransferase, cytosolic OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SHM2 PE=1 SV=4 209 390 2.0E-35
sp|Q60V73|GLYC_CAEBR Serine hydroxymethyltransferase OS=Caenorhabditis briggsae GN=mel-32 PE=3 SV=3 211 393 2.0E-35
sp|P50432|GLYC_CAEEL Serine hydroxymethyltransferase OS=Caenorhabditis elegans GN=mel-32 PE=1 SV=2 211 395 5.0E-34
sp|Q54EW1|GLYC2_DICDI Serine hydroxymethyltransferase 2 OS=Dictyostelium discoideum GN=shmt2 PE=3 SV=1 211 391 2.0E-31
sp|O23254|GLYC4_ARATH Serine hydroxymethyltransferase 4 OS=Arabidopsis thaliana GN=SHM4 PE=1 SV=1 209 391 1.0E-29
sp|Q9SVM4|GLYC5_ARATH Serine hydroxymethyltransferase 5 OS=Arabidopsis thaliana GN=SHM5 PE=3 SV=1 209 391 1.0E-28
sp|Q67N41|GLYA_SYMTH Serine hydroxymethyltransferase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=glyA PE=3 SV=1 209 342 4.0E-28
sp|A8MGL7|GLYA_ALKOO Serine hydroxymethyltransferase OS=Alkaliphilus oremlandii (strain OhILAs) GN=glyA PE=3 SV=1 209 343 3.0E-27
sp|Q54Z26|GLYC1_DICDI Serine hydroxymethyltransferase 1 OS=Dictyostelium discoideum GN=shmt1 PE=1 SV=1 211 391 6.0E-27
sp|B1V975|GLYA_PHYAS Serine hydroxymethyltransferase OS=Phytoplasma australiense GN=glyA PE=3 SV=1 209 333 8.0E-27
sp|Q6YR37|GLYA_ONYPE Serine hydroxymethyltransferase OS=Onion yellows phytoplasma (strain OY-M) GN=glyA PE=3 SV=1 209 333 8.0E-27
sp|Q2NIT8|GLYA_AYWBP Serine hydroxymethyltransferase OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=glyA PE=3 SV=1 209 333 2.0E-26
sp|B4SE31|GLYA_PELPB Serine hydroxymethyltransferase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=glyA PE=3 SV=1 202 333 1.0E-25
sp|A4J9B1|GLYA_DESRM Serine hydroxymethyltransferase OS=Desulfotomaculum reducens (strain MI-1) GN=glyA PE=3 SV=1 214 355 1.0E-25
sp|B2A3H6|GLYA_NATTJ Serine hydroxymethyltransferase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=glyA PE=3 SV=1 202 334 3.0E-25
sp|Q7VDS8|GLYA_PROMA Serine hydroxymethyltransferase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=glyA PE=3 SV=1 209 329 3.0E-25
sp|Q0IDD8|GLYA_SYNS3 Serine hydroxymethyltransferase OS=Synechococcus sp. (strain CC9311) GN=glyA PE=3 SV=1 209 329 9.0E-25
sp|Q3APN5|GLYA_CHLCH Serine hydroxymethyltransferase OS=Chlorobium chlorochromatii (strain CaD3) GN=glyA PE=3 SV=1 202 347 1.0E-24
sp|C4ZH69|GLYA_EUBR3 Serine hydroxymethyltransferase OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=glyA PE=3 SV=1 209 355 1.0E-24
sp|B9KAQ7|GLYA_THENN Serine hydroxymethyltransferase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=glyA PE=3 SV=1 209 330 2.0E-24
sp|Q5SI56|GLYA_THET8 Serine hydroxymethyltransferase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=glyA PE=1 SV=1 205 333 2.0E-24
sp|B1I6M4|GLYA_DESAP Serine hydroxymethyltransferase OS=Desulforudis audaxviator (strain MP104C) GN=glyA PE=3 SV=1 209 330 3.0E-24
sp|Q5V3D7|GLYA_HALMA Serine hydroxymethyltransferase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=glyA PE=3 SV=1 202 333 3.0E-24
sp|A4SFY3|GLYA_CHLPM Serine hydroxymethyltransferase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=glyA PE=3 SV=1 202 333 5.0E-24
sp|Q72IH2|GLYA_THET2 Serine hydroxymethyltransferase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=glyA PE=3 SV=2 205 333 5.0E-24
sp|B3R0G5|GLYA_PHYMT Serine hydroxymethyltransferase OS=Phytoplasma mali (strain AT) GN=glyA PE=3 SV=1 202 334 7.0E-24
sp|Q4UK96|GLYA_RICFE Serine hydroxymethyltransferase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=glyA PE=3 SV=1 202 330 7.0E-24
sp|A1BE30|GLYA_CHLPD Serine hydroxymethyltransferase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=glyA PE=3 SV=1 202 334 9.0E-24
sp|A0B8J6|GLYA_METTP Serine hydroxymethyltransferase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=glyA PE=3 SV=1 202 333 1.0E-23
sp|Q49Z60|GLYA_STAS1 Serine hydroxymethyltransferase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=glyA PE=3 SV=1 209 329 2.0E-23
sp|Q9RYB2|GLYA_DEIRA Serine hydroxymethyltransferase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=glyA PE=3 SV=2 209 333 2.0E-23
sp|B7JYG9|GLYA_CYAP8 Serine hydroxymethyltransferase OS=Cyanothece sp. (strain PCC 8801) GN=glyA PE=3 SV=1 209 329 2.0E-23
sp|Q111H1|GLYA_TRIEI Serine hydroxymethyltransferase OS=Trichodesmium erythraeum (strain IMS101) GN=glyA PE=3 SV=1 209 338 3.0E-23
sp|Q9LM59|GLYC6_ARATH Serine hydroxymethyltransferase 6 OS=Arabidopsis thaliana GN=SHM6 PE=2 SV=1 209 391 4.0E-23
sp|P77962|GLYA_SYNY3 Serine hydroxymethyltransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=glyA PE=3 SV=1 209 329 4.0E-23
sp|Q0ABQ9|GLYA_ALKEH Serine hydroxymethyltransferase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=glyA PE=3 SV=1 202 330 4.0E-23
sp|A0LI16|GLYA_SYNFM Serine hydroxymethyltransferase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=glyA PE=3 SV=1 186 390 4.0E-23
sp|B1HM45|GLYA_LYSSC Serine hydroxymethyltransferase OS=Lysinibacillus sphaericus (strain C3-41) GN=glyA PE=3 SV=1 202 350 4.0E-23
sp|Q5N2P9|GLYA_SYNP6 Serine hydroxymethyltransferase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=glyA PE=3 SV=2 209 338 9.0E-23
sp|Q31RK5|GLYA_SYNE7 Serine hydroxymethyltransferase OS=Synechococcus elongatus (strain PCC 7942) GN=glyA PE=3 SV=1 209 338 9.0E-23
sp|A7HJ69|GLYA_FERNB Serine hydroxymethyltransferase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=glyA PE=3 SV=1 209 329 1.0E-22
sp|Q0TP32|GLYA_CLOP1 Serine hydroxymethyltransferase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=glyA PE=3 SV=1 209 333 1.0E-22
sp|Q4L7Z4|GLYA_STAHJ Serine hydroxymethyltransferase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=glyA PE=3 SV=1 209 333 1.0E-22
sp|A3DEB1|GLYA_CLOTH Serine hydroxymethyltransferase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=glyA PE=3 SV=1 209 334 1.0E-22
sp|B7KD38|GLYA_CYAP7 Serine hydroxymethyltransferase OS=Cyanothece sp. (strain PCC 7424) GN=glyA PE=3 SV=1 205 329 1.0E-22
sp|O08370|GLYA_RICPR Serine hydroxymethyltransferase OS=Rickettsia prowazekii (strain Madrid E) GN=glyA PE=3 SV=1 202 329 1.0E-22
sp|A5GIG4|GLYA_SYNPW Serine hydroxymethyltransferase OS=Synechococcus sp. (strain WH7803) GN=glyA PE=3 SV=1 209 329 1.0E-22
sp|Q3A4L9|GLYA_PELCD Serine hydroxymethyltransferase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=glyA PE=3 SV=1 209 390 1.0E-22
sp|Q1J1W0|GLYA_DEIGD Serine hydroxymethyltransferase OS=Deinococcus geothermalis (strain DSM 11300) GN=glyA PE=3 SV=1 209 333 1.0E-22
sp|Q8EM73|GLYA_OCEIH Serine hydroxymethyltransferase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=glyA PE=3 SV=1 209 329 2.0E-22
sp|B0CEI9|GLYA_ACAM1 Serine hydroxymethyltransferase OS=Acaryochloris marina (strain MBIC 11017) GN=glyA PE=3 SV=1 209 338 2.0E-22
sp|B8GG35|GLYA_METPE Serine hydroxymethyltransferase OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=glyA PE=3 SV=1 202 333 2.0E-22
sp|Q24MM6|GLYA_DESHY Serine hydroxymethyltransferase OS=Desulfitobacterium hafniense (strain Y51) GN=glyA PE=3 SV=2 202 349 2.0E-22
sp|B8FZ69|GLYA_DESHD Serine hydroxymethyltransferase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=glyA PE=3 SV=1 202 349 2.0E-22
sp|B5YFZ0|GLYA_THEYD Serine hydroxymethyltransferase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=glyA PE=3 SV=1 209 333 3.0E-22
sp|B1YEH3|GLYA_EXIS2 Serine hydroxymethyltransferase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=glyA PE=3 SV=1 219 330 3.0E-22
sp|Q84WV0|GLYC7_ARATH Serine hydroxymethyltransferase 7 OS=Arabidopsis thaliana GN=SHM7 PE=2 SV=1 209 391 4.0E-22
sp|C5CEA8|GLYA_KOSOT Serine hydroxymethyltransferase OS=Kosmotoga olearia (strain TBF 19.5.1) GN=glyA PE=3 SV=1 202 333 4.0E-22
sp|B2KER5|GLYA_ELUMP Serine hydroxymethyltransferase OS=Elusimicrobium minutum (strain Pei191) GN=glyA PE=3 SV=1 209 390 4.0E-22
sp|Q8U7Y5|GLYA2_AGRFC Serine hydroxymethyltransferase 2 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=glyA2 PE=3 SV=1 202 350 4.0E-22
sp|Q3B2I7|GLYA_CHLL7 Serine hydroxymethyltransferase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=glyA PE=3 SV=1 202 342 5.0E-22
sp|Q68W07|GLYA_RICTY Serine hydroxymethyltransferase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=glyA PE=3 SV=1 202 329 5.0E-22
sp|Q3AW18|GLYA_SYNS9 Serine hydroxymethyltransferase OS=Synechococcus sp. (strain CC9902) GN=glyA PE=3 SV=1 209 329 6.0E-22
sp|B2V398|GLYA_CLOBA Serine hydroxymethyltransferase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=glyA PE=3 SV=1 209 333 8.0E-22
sp|A3PAX9|GLYA_PROM0 Serine hydroxymethyltransferase OS=Prochlorococcus marinus (strain MIT 9301) GN=glyA PE=3 SV=1 209 329 9.0E-22
sp|A9BDM9|GLYA_PROM4 Serine hydroxymethyltransferase OS=Prochlorococcus marinus (strain MIT 9211) GN=glyA PE=3 SV=1 209 329 9.0E-22
sp|A2BP57|GLYA_PROMS Serine hydroxymethyltransferase OS=Prochlorococcus marinus (strain AS9601) GN=glyA PE=3 SV=1 209 329 9.0E-22
sp|A5IGI2|GLYA_LEGPC Serine hydroxymethyltransferase OS=Legionella pneumophila (strain Corby) GN=glyA PE=3 SV=1 220 330 1.0E-21
sp|Q5WYH4|GLYA_LEGPL Serine hydroxymethyltransferase OS=Legionella pneumophila (strain Lens) GN=glyA PE=3 SV=1 220 330 1.0E-21
sp|Q8R887|GLYA_CALS4 Serine hydroxymethyltransferase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=glyA PE=3 SV=1 209 365 1.0E-21
sp|B3EFN5|GLYA_CHLL2 Serine hydroxymethyltransferase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=glyA PE=3 SV=2 202 334 1.0E-21
sp|B2TN52|GLYA_CLOBB Serine hydroxymethyltransferase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=glyA PE=3 SV=1 209 333 1.0E-21
sp|Q3MBD8|GLYA_ANAVT Serine hydroxymethyltransferase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=glyA PE=3 SV=1 205 329 1.0E-21
sp|Q31CS4|GLYA_PROM9 Serine hydroxymethyltransferase OS=Prochlorococcus marinus (strain MIT 9312) GN=glyA PE=3 SV=1 209 350 1.0E-21
sp|Q5ZXK6|GLYA_LEGPH Serine hydroxymethyltransferase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=glyA PE=3 SV=1 220 330 2.0E-21
sp|Q5X722|GLYA_LEGPA Serine hydroxymethyltransferase OS=Legionella pneumophila (strain Paris) GN=glyA PE=3 SV=1 220 330 2.0E-21
sp|B1L7Y6|GLYA_THESQ Serine hydroxymethyltransferase OS=Thermotoga sp. (strain RQ2) GN=glyA PE=3 SV=1 209 317 2.0E-21
sp|Q9WZH9|GLYA_THEMA Serine hydroxymethyltransferase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=glyA PE=3 SV=1 209 317 2.0E-21
sp|Q5KUI2|GLYA_GEOKA Serine hydroxymethyltransferase OS=Geobacillus kaustophilus (strain HTA426) GN=glyA PE=3 SV=1 209 329 2.0E-21
sp|Q0AUC3|GLYA_SYNWW Serine hydroxymethyltransferase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=glyA PE=3 SV=1 209 341 2.0E-21
sp|A9KSH6|GLYA_CLOPH Serine hydroxymethyltransferase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=glyA PE=3 SV=1 209 348 2.0E-21
sp|B2FNK2|GLYA_STRMK Serine hydroxymethyltransferase OS=Stenotrophomonas maltophilia (strain K279a) GN=glyA PE=3 SV=1 202 330 2.0E-21
sp|Q2G646|GLYA_NOVAD Serine hydroxymethyltransferase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=glyA PE=3 SV=1 209 333 2.0E-21
sp|Q3AN03|GLYA_SYNSC Serine hydroxymethyltransferase OS=Synechococcus sp. (strain CC9605) GN=glyA PE=3 SV=1 209 329 2.0E-21
sp|A5IJ65|GLYA_THEP1 Serine hydroxymethyltransferase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=glyA PE=3 SV=1 209 317 3.0E-21
sp|A6LKU9|GLYA_THEM4 Serine hydroxymethyltransferase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=glyA PE=3 SV=1 209 333 3.0E-21
sp|B2J2A2|GLYA_NOSP7 Serine hydroxymethyltransferase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=glyA PE=3 SV=1 205 334 3.0E-21
sp|A6VXM6|GLYA_MARMS Serine hydroxymethyltransferase OS=Marinomonas sp. (strain MWYL1) GN=glyA PE=3 SV=1 202 333 3.0E-21
sp|A4ITJ9|GLYA_GEOTN Serine hydroxymethyltransferase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=glyA PE=3 SV=1 209 329 4.0E-21
sp|Q74CR5|GLYA_GEOSL Serine hydroxymethyltransferase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=glyA PE=3 SV=1 209 334 4.0E-21
sp|O62585|GLYC_ENCCU Serine hydroxymethyltransferase, cytosolic OS=Encephalitozoon cuniculi (strain GB-M1) GN=SHMT-1 PE=3 SV=2 211 348 5.0E-21
sp|Q46HB6|GLYA_PROMT Serine hydroxymethyltransferase OS=Prochlorococcus marinus (strain NATL2A) GN=glyA PE=3 SV=1 209 329 5.0E-21
sp|P24060|GLYA_BRADU Serine hydroxymethyltransferase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=glyA PE=3 SV=2 202 329 5.0E-21
sp|A5I526|GLYA_CLOBH Serine hydroxymethyltransferase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=glyA PE=3 SV=1 209 333 6.0E-21
sp|A7FWM6|GLYA_CLOB1 Serine hydroxymethyltransferase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=glyA PE=3 SV=1 209 333 6.0E-21
sp|A5N7P5|GLYA_CLOK5 Serine hydroxymethyltransferase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=glyA PE=3 SV=1 209 333 6.0E-21
sp|B9E156|GLYA_CLOK1 Serine hydroxymethyltransferase OS=Clostridium kluyveri (strain NBRC 12016) GN=glyA PE=3 SV=1 209 333 6.0E-21
sp|B0K631|GLYA_THEPX Serine hydroxymethyltransferase OS=Thermoanaerobacter sp. (strain X514) GN=glyA PE=3 SV=1 209 329 6.0E-21
sp|B0K742|GLYA_THEP3 Serine hydroxymethyltransferase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=glyA PE=3 SV=1 209 329 6.0E-21
sp|C1FTF1|GLYA_CLOBJ Serine hydroxymethyltransferase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=glyA PE=3 SV=1 209 333 7.0E-21
sp|B1IJJ8|GLYA_CLOBK Serine hydroxymethyltransferase OS=Clostridium botulinum (strain Okra / Type B1) GN=glyA PE=3 SV=1 209 333 7.0E-21
sp|B1KXQ5|GLYA_CLOBM Serine hydroxymethyltransferase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=glyA PE=3 SV=1 209 333 7.0E-21
sp|C3L181|GLYA_CLOB6 Serine hydroxymethyltransferase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=glyA PE=3 SV=1 209 333 7.0E-21
sp|Q8YMW8|GLYA_NOSS1 Serine hydroxymethyltransferase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=glyA PE=3 SV=1 205 329 7.0E-21
sp|Q214H7|GLYA_RHOPB Serine hydroxymethyltransferase OS=Rhodopseudomonas palustris (strain BisB18) GN=glyA PE=3 SV=1 202 329 7.0E-21
sp|A2BUN9|GLYA_PROM5 Serine hydroxymethyltransferase OS=Prochlorococcus marinus (strain MIT 9515) GN=glyA PE=3 SV=1 209 329 8.0E-21
sp|B2IJJ3|GLYA_BEII9 Serine hydroxymethyltransferase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=glyA PE=3 SV=1 202 329 8.0E-21
sp|Q7W1I6|GLYA1_BORPA Serine hydroxymethyltransferase 1 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=glyA1 PE=3 SV=1 209 349 9.0E-21
sp|Q7WPH6|GLYA1_BORBR Serine hydroxymethyltransferase 1 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=glyA1 PE=3 SV=1 209 349 9.0E-21
sp|B4SJB0|GLYA_STRM5 Serine hydroxymethyltransferase OS=Stenotrophomonas maltophilia (strain R551-3) GN=glyA PE=3 SV=1 202 348 9.0E-21
sp|B4S5Y9|GLYA_PROA2 Serine hydroxymethyltransferase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=glyA PE=3 SV=1 209 390 1.0E-20
sp|A7GGI2|GLYA_CLOBL Serine hydroxymethyltransferase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=glyA PE=3 SV=1 209 333 1.0E-20
sp|A0KNH4|GLYA_AERHH Serine hydroxymethyltransferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=glyA PE=3 SV=1 202 338 1.0E-20
sp|B7GMG4|GLYA_ANOFW Serine hydroxymethyltransferase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=glyA PE=3 SV=1 209 347 2.0E-20
sp|A4SJN4|GLYA_AERS4 Serine hydroxymethyltransferase OS=Aeromonas salmonicida (strain A449) GN=glyA PE=3 SV=1 202 330 2.0E-20
sp|A2C090|GLYA_PROM1 Serine hydroxymethyltransferase OS=Prochlorococcus marinus (strain NATL1A) GN=glyA PE=3 SV=1 209 329 2.0E-20
sp|A5EKI3|GLYA_BRASB Serine hydroxymethyltransferase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=glyA PE=3 SV=1 220 329 2.0E-20
sp|Q046F8|GLYA_LACGA Serine hydroxymethyltransferase OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=glyA PE=3 SV=1 205 329 3.0E-20
sp|Q39V87|GLYA_GEOMG Serine hydroxymethyltransferase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=glyA PE=3 SV=1 202 365 3.0E-20
sp|Q7ND67|GLYA_GLOVI Serine hydroxymethyltransferase OS=Gloeobacter violaceus (strain PCC 7421) GN=glyA PE=3 SV=1 209 329 3.0E-20
sp|Q607U4|GLYA_METCA Serine hydroxymethyltransferase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=glyA PE=3 SV=1 209 321 3.0E-20
sp|Q3J9K8|GLYA_NITOC Serine hydroxymethyltransferase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=glyA PE=3 SV=1 209 330 3.0E-20
sp|A4YW97|GLYA_BRASO Serine hydroxymethyltransferase OS=Bradyrhizobium sp. (strain ORS278) GN=glyA PE=3 SV=1 220 350 3.0E-20
sp|Q38WJ7|GLYA_LACSS Serine hydroxymethyltransferase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=glyA PE=3 SV=1 209 329 4.0E-20
sp|A0M3N2|GLYA_GRAFK Serine hydroxymethyltransferase OS=Gramella forsetii (strain KT0803) GN=glyA PE=3 SV=1 209 334 6.0E-20
sp|A0PZX4|GLYA_CLONN Serine hydroxymethyltransferase OS=Clostridium novyi (strain NT) GN=glyA PE=3 SV=1 209 333 6.0E-20
sp|C1CYT8|GLYA_DEIDV Serine hydroxymethyltransferase OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=glyA PE=3 SV=1 209 391 6.0E-20
sp|B3EMW0|GLYA_CHLPB Serine hydroxymethyltransferase OS=Chlorobium phaeobacteroides (strain BS1) GN=glyA PE=3 SV=2 209 334 8.0E-20
sp|C6E348|GLYA_GEOSM Serine hydroxymethyltransferase OS=Geobacter sp. (strain M21) GN=glyA PE=3 SV=1 202 365 1.0E-19
sp|A3QC57|GLYA_SHELP Serine hydroxymethyltransferase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=glyA PE=3 SV=1 202 330 1.0E-19
sp|A1S4B5|GLYA_SHEAM Serine hydroxymethyltransferase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=glyA PE=3 SV=1 202 332 1.0E-19
sp|A7NIF2|GLYA_ROSCS Serine hydroxymethyltransferase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=glyA PE=3 SV=1 209 333 1.0E-19
sp|B8I2N8|GLYA_CLOCE Serine hydroxymethyltransferase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=glyA PE=3 SV=1 209 334 1.0E-19
sp|Q2SFI7|GLYA1_HAHCH Serine hydroxymethyltransferase 1 OS=Hahella chejuensis (strain KCTC 2396) GN=glyA1 PE=3 SV=1 202 330 1.0E-19
sp|Q8PZQ0|GLYA_METMA Serine hydroxymethyltransferase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=glyA PE=3 SV=2 209 333 2.0E-19
sp|B7IHE6|GLYA_THEAB Serine hydroxymethyltransferase OS=Thermosipho africanus (strain TCF52B) GN=glyA PE=3 SV=1 209 329 2.0E-19
sp|B8G933|GLYA_CHLAD Serine hydroxymethyltransferase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=glyA PE=3 SV=1 202 326 2.0E-19
sp|Q01QZ0|GLYA_SOLUE Serine hydroxymethyltransferase OS=Solibacter usitatus (strain Ellin6076) GN=glyA PE=3 SV=1 209 329 2.0E-19
sp|Q87RR2|GLYA1_VIBPA Serine hydroxymethyltransferase 1 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=glyA1 PE=3 SV=1 202 330 2.0E-19
sp|Q7MN19|GLYA1_VIBVY Serine hydroxymethyltransferase 1 OS=Vibrio vulnificus (strain YJ016) GN=glyA1 PE=3 SV=1 202 330 2.0E-19
sp|Q8DFC9|GLYA1_VIBVU Serine hydroxymethyltransferase 1 OS=Vibrio vulnificus (strain CMCP6) GN=glyA1 PE=3 SV=1 202 330 2.0E-19
sp|O66776|GLYA_AQUAE Serine hydroxymethyltransferase OS=Aquifex aeolicus (strain VF5) GN=glyA PE=3 SV=1 202 390 2.0E-19
sp|Q0HL93|GLYA_SHESM Serine hydroxymethyltransferase OS=Shewanella sp. (strain MR-4) GN=glyA PE=3 SV=1 202 332 2.0E-19
sp|Q0HXJ6|GLYA_SHESR Serine hydroxymethyltransferase OS=Shewanella sp. (strain MR-7) GN=glyA PE=3 SV=1 202 332 2.0E-19
sp|A0KU60|GLYA_SHESA Serine hydroxymethyltransferase OS=Shewanella sp. (strain ANA-3) GN=glyA PE=3 SV=1 202 332 2.0E-19
sp|Q12Q48|GLYA_SHEDO Serine hydroxymethyltransferase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=glyA PE=3 SV=1 202 332 2.0E-19
sp|Q6FA66|GLYA_ACIAD Serine hydroxymethyltransferase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=glyA PE=3 SV=1 209 330 2.0E-19
sp|Q9HTE9|GLYA1_PSEAE Serine hydroxymethyltransferase 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=glyA1 PE=3 SV=1 209 319 2.0E-19
sp|Q65DW5|GLYA_BACLD Serine hydroxymethyltransferase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=glyA PE=3 SV=1 209 361 3.0E-19
sp|B5E8U0|GLYA_GEOBB Serine hydroxymethyltransferase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=glyA PE=3 SV=1 202 350 3.0E-19
sp|B0VBB3|GLYA_ACIBY Serine hydroxymethyltransferase OS=Acinetobacter baumannii (strain AYE) GN=glyA PE=3 SV=1 209 330 3.0E-19
sp|A3M736|GLYA_ACIBT Serine hydroxymethyltransferase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=glyA PE=3 SV=2 209 330 3.0E-19
sp|B2HUY9|GLYA_ACIBC Serine hydroxymethyltransferase OS=Acinetobacter baumannii (strain ACICU) GN=glyA PE=3 SV=1 209 330 3.0E-19
sp|B7I2R7|GLYA_ACIB5 Serine hydroxymethyltransferase OS=Acinetobacter baumannii (strain AB0057) GN=glyA PE=3 SV=1 209 330 3.0E-19
sp|B7GZR6|GLYA_ACIB3 Serine hydroxymethyltransferase OS=Acinetobacter baumannii (strain AB307-0294) GN=glyA PE=3 SV=1 209 330 3.0E-19
sp|O85718|GLYA_ACIRA Serine hydroxymethyltransferase OS=Acinetobacter radioresistens GN=glyA PE=3 SV=1 209 361 3.0E-19
sp|Q4FUZ8|GLYA_PSYA2 Serine hydroxymethyltransferase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=glyA PE=3 SV=1 209 361 3.0E-19
sp|Q7MXW0|GLYA_PORGI Serine hydroxymethyltransferase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=glyA PE=3 SV=1 209 334 4.0E-19
sp|B2RGR2|GLYA_PORG3 Serine hydroxymethyltransferase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=glyA PE=3 SV=1 209 334 4.0E-19
sp|B9LKK8|GLYA_CHLSY Serine hydroxymethyltransferase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=glyA PE=3 SV=1 202 326 4.0E-19
sp|Q46A52|GLYA_METBF Serine hydroxymethyltransferase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=glyA PE=1 SV=1 202 333 4.0E-19
sp|A7Z9Q9|GLYA_BACMF Serine hydroxymethyltransferase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=glyA PE=3 SV=1 209 333 4.0E-19
sp|C1DEQ3|GLYA_AZOVD Serine hydroxymethyltransferase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=glyA PE=3 SV=1 209 321 4.0E-19
sp|B2GM31|GLYA_KOCRD Serine hydroxymethyltransferase OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=glyA PE=3 SV=1 202 333 4.0E-19
sp|Q8TK94|GLYA_METAC Serine hydroxymethyltransferase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=glyA PE=3 SV=1 209 333 5.0E-19
sp|A9WI58|GLYA_CHLAA Serine hydroxymethyltransferase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=glyA PE=3 SV=1 202 326 5.0E-19
sp|B0S1N3|GLYA_FINM2 Serine hydroxymethyltransferase OS=Finegoldia magna (strain ATCC 29328) GN=glyA PE=3 SV=1 209 329 5.0E-19
sp|B8DBH0|GLYA_LISMH Serine hydroxymethyltransferase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=glyA PE=3 SV=1 202 333 5.0E-19
sp|Q71WN9|GLYA_LISMF Serine hydroxymethyltransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=glyA PE=3 SV=1 202 333 5.0E-19
sp|C1KYV6|GLYA_LISMC Serine hydroxymethyltransferase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=glyA PE=3 SV=1 202 333 5.0E-19
sp|Q927V4|GLYA_LISIN Serine hydroxymethyltransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=glyA PE=3 SV=1 202 333 5.0E-19
sp|Q601P7|GLYA_MYCH2 Serine hydroxymethyltransferase OS=Mycoplasma hyopneumoniae (strain 232) GN=glyA PE=3 SV=1 209 330 5.0E-19
sp|Q4AAB2|GLYA_MYCHJ Serine hydroxymethyltransferase OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=glyA PE=3 SV=1 209 330 5.0E-19
sp|C4LAE6|GLYA_TOLAT Serine hydroxymethyltransferase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=glyA PE=3 SV=1 202 350 5.0E-19
sp|A6L5K3|GLYA_BACV8 Serine hydroxymethyltransferase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=glyA PE=3 SV=1 209 390 6.0E-19
sp|Q04FR7|GLYA_OENOB Serine hydroxymethyltransferase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=glyA PE=3 SV=1 220 333 6.0E-19
sp|Q4A8E1|GLYA_MYCH7 Serine hydroxymethyltransferase OS=Mycoplasma hyopneumoniae (strain 7448) GN=glyA PE=3 SV=1 209 330 6.0E-19
sp|Q2W4T2|GLYA_MAGSA Serine hydroxymethyltransferase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=glyA PE=3 SV=1 202 329 6.0E-19
sp|Q1IS84|GLYA_KORVE Serine hydroxymethyltransferase OS=Koribacter versatilis (strain Ellin345) GN=glyA PE=3 SV=1 209 325 7.0E-19
sp|Q3Z9B9|GLYA_DEHM1 Serine hydroxymethyltransferase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=glyA PE=3 SV=1 202 317 7.0E-19
sp|B0VLF5|GLYA_ACIBS Serine hydroxymethyltransferase OS=Acinetobacter baumannii (strain SDF) GN=glyA PE=3 SV=1 202 330 7.0E-19
sp|A5UQB7|GLYA_ROSS1 Serine hydroxymethyltransferase OS=Roseiflexus sp. (strain RS-1) GN=glyA PE=3 SV=1 209 333 8.0E-19
sp|Q4ZM83|GLYA2_PSEU2 Serine hydroxymethyltransferase 2 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=glyA2 PE=3 SV=1 209 347 9.0E-19
sp|Q81JY4|GLYA_BACAN Serine hydroxymethyltransferase OS=Bacillus anthracis GN=glyA PE=3 SV=1 202 363 1.0E-18
sp|C3LFJ0|GLYA_BACAC Serine hydroxymethyltransferase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=glyA PE=3 SV=1 202 363 1.0E-18
sp|C3P1G5|GLYA_BACAA Serine hydroxymethyltransferase OS=Bacillus anthracis (strain A0248) GN=glyA PE=3 SV=1 202 363 1.0E-18
sp|Q32D21|GLYA_SHIDS Serine hydroxymethyltransferase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=glyA PE=3 SV=1 202 330 1.0E-18
sp|P0A827|GLYA_SHIFL Serine hydroxymethyltransferase OS=Shigella flexneri GN=glyA PE=3 SV=1 202 330 1.0E-18
sp|Q0T1W9|GLYA_SHIF8 Serine hydroxymethyltransferase OS=Shigella flexneri serotype 5b (strain 8401) GN=glyA PE=3 SV=1 202 330 1.0E-18
sp|Q31XT6|GLYA_SHIBS Serine hydroxymethyltransferase OS=Shigella boydii serotype 4 (strain Sb227) GN=glyA PE=3 SV=1 202 330 1.0E-18
sp|B2TXW4|GLYA_SHIB3 Serine hydroxymethyltransferase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=glyA PE=3 SV=1 202 330 1.0E-18
sp|Q1R8I4|GLYA_ECOUT Serine hydroxymethyltransferase OS=Escherichia coli (strain UTI89 / UPEC) GN=glyA PE=3 SV=2 202 330 1.0E-18
sp|B1LNK7|GLYA_ECOSM Serine hydroxymethyltransferase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=glyA PE=3 SV=1 202 330 1.0E-18
sp|B6I5C4|GLYA_ECOSE Serine hydroxymethyltransferase OS=Escherichia coli (strain SE11) GN=glyA PE=3 SV=1 202 330 1.0E-18
sp|P0A825|GLYA_ECOLI Serine hydroxymethyltransferase OS=Escherichia coli (strain K12) GN=glyA PE=1 SV=1 202 330 1.0E-18
sp|B1IVS6|GLYA_ECOLC Serine hydroxymethyltransferase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=glyA PE=3 SV=1 202 330 1.0E-18
sp|P0A826|GLYA_ECOL6 Serine hydroxymethyltransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=glyA PE=3 SV=1 202 330 1.0E-18
sp|Q0TET8|GLYA_ECOL5 Serine hydroxymethyltransferase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=glyA PE=3 SV=1 202 330 1.0E-18
sp|A1AE82|GLYA_ECOK1 Serine hydroxymethyltransferase OS=Escherichia coli O1:K1 / APEC GN=glyA PE=3 SV=2 202 330 1.0E-18
sp|A8A359|GLYA_ECOHS Serine hydroxymethyltransferase OS=Escherichia coli O9:H4 (strain HS) GN=glyA PE=3 SV=1 202 330 1.0E-18
sp|B1XB26|GLYA_ECODH Serine hydroxymethyltransferase OS=Escherichia coli (strain K12 / DH10B) GN=glyA PE=3 SV=1 202 330 1.0E-18
sp|C4ZXC6|GLYA_ECOBW Serine hydroxymethyltransferase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=glyA PE=3 SV=1 202 330 1.0E-18
sp|B7M8A7|GLYA_ECO8A Serine hydroxymethyltransferase OS=Escherichia coli O8 (strain IAI1) GN=glyA PE=3 SV=1 202 330 1.0E-18
sp|B7MYI0|GLYA_ECO81 Serine hydroxymethyltransferase OS=Escherichia coli O81 (strain ED1a) GN=glyA PE=3 SV=1 202 330 1.0E-18
sp|B7NRK2|GLYA_ECO7I Serine hydroxymethyltransferase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=glyA PE=3 SV=1 202 330 1.0E-18
sp|B7LDE3|GLYA_ECO55 Serine hydroxymethyltransferase OS=Escherichia coli (strain 55989 / EAEC) GN=glyA PE=3 SV=1 202 330 1.0E-18
sp|B7MIN5|GLYA_ECO45 Serine hydroxymethyltransferase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=glyA PE=3 SV=1 202 330 1.0E-18
sp|B7UGZ1|GLYA_ECO27 Serine hydroxymethyltransferase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=glyA PE=3 SV=1 202 330 1.0E-18
sp|A7ZPZ4|GLYA_ECO24 Serine hydroxymethyltransferase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=glyA PE=3 SV=1 202 330 1.0E-18
sp|Q3YZ04|GLYA_SHISS Serine hydroxymethyltransferase OS=Shigella sonnei (strain Ss046) GN=glyA PE=3 SV=1 202 330 1.0E-18
sp|B7N6D8|GLYA_ECOLU Serine hydroxymethyltransferase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=glyA PE=3 SV=1 202 330 1.0E-18
sp|A5FS31|GLYA_DEHMB Serine hydroxymethyltransferase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=glyA PE=3 SV=1 202 317 2.0E-18
sp|Q3ZZG3|GLYA_DEHMC Serine hydroxymethyltransferase OS=Dehalococcoides mccartyi (strain CBDB1) GN=glyA PE=3 SV=1 202 317 2.0E-18
sp|Q48CP3|GLYA2_PSE14 Serine hydroxymethyltransferase 2 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=glyA2 PE=3 SV=1 209 330 2.0E-18
sp|Q6LU17|GLYA1_PHOPR Serine hydroxymethyltransferase 1 OS=Photobacterium profundum GN=glyA1 PE=3 SV=1 202 330 2.0E-18
sp|A0ALM4|GLYA_LISW6 Serine hydroxymethyltransferase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=glyA PE=3 SV=1 202 333 2.0E-18
sp|B3E1Z8|GLYA_GEOLS Serine hydroxymethyltransferase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=glyA PE=3 SV=1 202 334 2.0E-18
sp|Q8Y4B2|GLYA_LISMO Serine hydroxymethyltransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=glyA PE=3 SV=1 202 333 2.0E-18
sp|Q88AD1|GLYA1_PSESM Serine hydroxymethyltransferase 1 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=glyA1 PE=3 SV=1 209 347 2.0E-18
sp|Q1QE01|GLYA_PSYCK Serine hydroxymethyltransferase OS=Psychrobacter cryohalolentis (strain K5) GN=glyA PE=3 SV=1 209 361 2.0E-18
sp|Q7MAR0|GLYA_WOLSU Serine hydroxymethyltransferase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=glyA PE=3 SV=1 209 330 2.0E-18
sp|B5Z123|GLYA_ECO5E Serine hydroxymethyltransferase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=glyA PE=3 SV=1 202 330 2.0E-18
sp|Q8XA55|GLYA_ECO57 Serine hydroxymethyltransferase OS=Escherichia coli O157:H7 GN=glyA PE=3 SV=1 202 330 2.0E-18
sp|B3QUG2|GLYA_CHLT3 Serine hydroxymethyltransferase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=glyA PE=3 SV=1 202 334 2.0E-18
sp|P39148|GLYA_BACSU Serine hydroxymethyltransferase OS=Bacillus subtilis (strain 168) GN=glyA PE=1 SV=1 209 361 3.0E-18
sp|Q9KTG1|GLYA1_VIBCH Serine hydroxymethyltransferase 1 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=glyA1 PE=3 SV=2 202 330 3.0E-18
sp|A4Y966|GLYA_SHEPC Serine hydroxymethyltransferase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=glyA PE=3 SV=1 202 332 3.0E-18
sp|Q8EBN8|GLYA_SHEON Serine hydroxymethyltransferase OS=Shewanella oneidensis (strain MR-1) GN=glyA PE=3 SV=1 202 332 3.0E-18
sp|Q47MD6|GLYA_THEFY Serine hydroxymethyltransferase OS=Thermobifida fusca (strain YX) GN=glyA PE=3 SV=1 219 333 3.0E-18
sp|Q21NP8|GLYA_SACD2 Serine hydroxymethyltransferase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=glyA PE=3 SV=1 209 329 3.0E-18
sp|B8D981|GLYA_BUCA5 Serine hydroxymethyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=glyA PE=3 SV=1 202 329 3.0E-18
sp|B3PBD6|GLYA_CELJU Serine hydroxymethyltransferase OS=Cellvibrio japonicus (strain Ueda107) GN=glyA PE=3 SV=1 209 329 4.0E-18
sp|A6WR52|GLYA_SHEB8 Serine hydroxymethyltransferase OS=Shewanella baltica (strain OS185) GN=glyA PE=3 SV=1 202 332 4.0E-18
sp|A9KYJ6|GLYA_SHEB9 Serine hydroxymethyltransferase OS=Shewanella baltica (strain OS195) GN=glyA PE=3 SV=1 202 332 4.0E-18
sp|B8E6W1|GLYA_SHEB2 Serine hydroxymethyltransferase OS=Shewanella baltica (strain OS223) GN=glyA PE=3 SV=1 202 332 4.0E-18
sp|A1RHD0|GLYA_SHESW Serine hydroxymethyltransferase OS=Shewanella sp. (strain W3-18-1) GN=glyA PE=3 SV=1 202 332 4.0E-18
sp|B5ELV3|GLYA_ACIF5 Serine hydroxymethyltransferase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=glyA PE=3 SV=1 202 330 4.0E-18
sp|B7J439|GLYA_ACIF2 Serine hydroxymethyltransferase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=glyA PE=3 SV=1 202 330 4.0E-18
sp|A3D7D0|GLYA_SHEB5 Serine hydroxymethyltransferase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=glyA PE=3 SV=1 202 319 5.0E-18
sp|Q88Q27|GLYA2_PSEPK Serine hydroxymethyltransferase 2 OS=Pseudomonas putida (strain KT2440) GN=glyA2 PE=3 SV=1 209 326 5.0E-18
sp|Q87WC1|GLYA2_PSESM Serine hydroxymethyltransferase 2 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=glyA2 PE=3 SV=1 209 326 5.0E-18
sp|Q48DU7|GLYA1_PSE14 Serine hydroxymethyltransferase 1 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=glyA1 PE=3 SV=1 209 326 5.0E-18
sp|Q3K6J0|GLYA2_PSEPF Serine hydroxymethyltransferase 2 OS=Pseudomonas fluorescens (strain Pf0-1) GN=glyA2 PE=3 SV=1 209 326 6.0E-18
sp|Q4ZNH2|GLYA1_PSEU2 Serine hydroxymethyltransferase 1 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=glyA1 PE=3 SV=1 209 326 6.0E-18
sp|Q73GC3|GLYA_WOLPM Serine hydroxymethyltransferase OS=Wolbachia pipientis wMel GN=glyA PE=3 SV=1 202 333 6.0E-18
sp|Q2JT50|GLYA_SYNJA Serine hydroxymethyltransferase OS=Synechococcus sp. (strain JA-3-3Ab) GN=glyA PE=3 SV=1 205 329 7.0E-18
sp|A8FIC1|GLYA_BACP2 Serine hydroxymethyltransferase OS=Bacillus pumilus (strain SAFR-032) GN=glyA PE=3 SV=1 209 361 7.0E-18
sp|Q2YD58|GLYA_NITMU Serine hydroxymethyltransferase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=glyA PE=3 SV=1 202 329 7.0E-18
sp|A4VI36|GLYA_PSEU5 Serine hydroxymethyltransferase OS=Pseudomonas stutzeri (strain A1501) GN=glyA PE=3 SV=1 209 330 8.0E-18
sp|Q8KC36|GLYA_CHLTE Serine hydroxymethyltransferase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=glyA PE=3 SV=1 202 349 9.0E-18
sp|Q64U78|GLYA_BACFR Serine hydroxymethyltransferase OS=Bacteroides fragilis (strain YCH46) GN=glyA PE=3 SV=1 209 390 9.0E-18
sp|Q5LD58|GLYA_BACFN Serine hydroxymethyltransferase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=glyA PE=3 SV=1 209 390 9.0E-18
sp|Q0SMQ5|GLYA_BORAP Serine hydroxymethyltransferase OS=Borrelia afzelii (strain PKo) GN=glyA PE=3 SV=1 205 333 9.0E-18
sp|Q6AM21|GLYA_DESPS Serine hydroxymethyltransferase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=glyA PE=3 SV=1 209 333 1.0E-17
sp|Q9I138|GLYA2_PSEAE Serine hydroxymethyltransferase 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=glyA2 PE=3 SV=1 209 330 1.0E-17
sp|B5FBF0|GLYA_VIBFM Serine hydroxymethyltransferase OS=Vibrio fischeri (strain MJ11) GN=glyA PE=3 SV=1 202 330 1.0E-17
sp|Q5E706|GLYA_VIBF1 Serine hydroxymethyltransferase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=glyA PE=3 SV=1 202 330 1.0E-17
sp|B7J2G3|GLYA_BORBZ Serine hydroxymethyltransferase OS=Borrelia burgdorferi (strain ZS7) GN=glyA PE=3 SV=1 170 333 1.0E-17
sp|O51547|GLYA_BORBU Serine hydroxymethyltransferase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=glyA PE=3 SV=1 170 333 1.0E-17
sp|Q8A9S7|GLYA_BACTN Serine hydroxymethyltransferase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=glyA PE=3 SV=1 209 393 2.0E-17
sp|Q88UT5|GLYA_LACPL Serine hydroxymethyltransferase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=glyA PE=3 SV=1 211 333 2.0E-17
sp|A1TYW8|GLYA_MARHV Serine hydroxymethyltransferase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=glyA PE=3 SV=1 209 330 2.0E-17
sp|Q5QXT4|GLYA_IDILO Serine hydroxymethyltransferase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=glyA PE=3 SV=1 205 329 2.0E-17
sp|Q4K5R9|GLYA1_PSEF5 Serine hydroxymethyltransferase 1 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=glyA1 PE=3 SV=1 209 319 3.0E-17
sp|B6EHX0|GLYA_ALISL Serine hydroxymethyltransferase OS=Aliivibrio salmonicida (strain LFI1238) GN=glyA PE=3 SV=1 202 330 3.0E-17
sp|Q9HVI7|GLYA3_PSEAE Serine hydroxymethyltransferase 3 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=glyA2 PE=3 SV=1 209 319 3.0E-17
sp|Q1WTR3|GLYA_LACS1 Serine hydroxymethyltransferase OS=Lactobacillus salivarius (strain UCC118) GN=glyA PE=3 SV=1 205 390 4.0E-17
sp|A9GPH2|GLYA_SORC5 Serine hydroxymethyltransferase OS=Sorangium cellulosum (strain So ce56) GN=glyA PE=3 SV=1 222 356 4.0E-17
sp|C0PYJ5|GLYA_SALPC Serine hydroxymethyltransferase OS=Salmonella paratyphi C (strain RKS4594) GN=glyA PE=3 SV=1 202 330 5.0E-17
sp|P0A2E1|GLYA_SALTY Serine hydroxymethyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=glyA PE=1 SV=1 202 330 5.0E-17
sp|B5BAV4|GLYA_SALPK Serine hydroxymethyltransferase OS=Salmonella paratyphi A (strain AKU_12601) GN=glyA PE=3 SV=1 202 330 5.0E-17
sp|A9N1W0|GLYA_SALPB Serine hydroxymethyltransferase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=glyA PE=3 SV=1 202 330 5.0E-17
sp|Q5PII3|GLYA_SALPA Serine hydroxymethyltransferase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=glyA PE=3 SV=1 202 330 5.0E-17
sp|B4T1D1|GLYA_SALNS Serine hydroxymethyltransferase OS=Salmonella newport (strain SL254) GN=glyA PE=3 SV=1 202 330 5.0E-17
sp|B4TDC8|GLYA_SALHS Serine hydroxymethyltransferase OS=Salmonella heidelberg (strain SL476) GN=glyA PE=3 SV=1 202 330 5.0E-17
sp|Q57LF7|GLYA_SALCH Serine hydroxymethyltransferase OS=Salmonella choleraesuis (strain SC-B67) GN=glyA PE=3 SV=1 202 330 5.0E-17
sp|B5F1D2|GLYA_SALA4 Serine hydroxymethyltransferase OS=Salmonella agona (strain SL483) GN=glyA PE=3 SV=1 202 330 5.0E-17
sp|P0A2E2|GLYA1_SALTI Serine hydroxymethyltransferase 1 OS=Salmonella typhi GN=glyA1 PE=1 SV=1 202 330 5.0E-17
sp|B4TRY8|GLYA_SALSV Serine hydroxymethyltransferase OS=Salmonella schwarzengrund (strain CVM19633) GN=glyA PE=3 SV=1 202 330 5.0E-17
sp|A8AD38|GLYA_CITK8 Serine hydroxymethyltransferase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=glyA PE=3 SV=2 202 330 7.0E-17
sp|B3QPR3|GLYA_CHLP8 Serine hydroxymethyltransferase OS=Chlorobaculum parvum (strain NCIB 8327) GN=glyA PE=3 SV=1 202 334 1.0E-16
sp|Q65T08|GLYA_MANSM Serine hydroxymethyltransferase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=glyA PE=3 SV=1 209 321 1.0E-16
sp|P57830|GLYA_PASMU Serine hydroxymethyltransferase OS=Pasteurella multocida (strain Pm70) GN=glyA PE=3 SV=1 209 330 1.0E-16
sp|Q98A81|GLYA2_RHILO Serine hydroxymethyltransferase 2 OS=Rhizobium loti (strain MAFF303099) GN=glyA2 PE=3 SV=1 209 338 1.0E-16
sp|Q481S6|GLYA2_COLP3 Serine hydroxymethyltransferase 2 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=glyA2 PE=3 SV=1 209 330 1.0E-16
sp|Q3YRD1|GLYA_EHRCJ Serine hydroxymethyltransferase OS=Ehrlichia canis (strain Jake) GN=glyA PE=3 SV=1 202 329 1.0E-16
sp|Q5HAJ7|GLYA_EHRRW Serine hydroxymethyltransferase OS=Ehrlichia ruminantium (strain Welgevonden) GN=glyA PE=3 SV=1 209 330 1.0E-16
sp|Q5FG30|GLYA_EHRRG Serine hydroxymethyltransferase OS=Ehrlichia ruminantium (strain Gardel) GN=glyA PE=3 SV=1 209 330 1.0E-16
sp|P34894|GLYA_AGGAC Serine hydroxymethyltransferase OS=Aggregatibacter actinomycetemcomitans GN=glyA PE=3 SV=1 209 330 1.0E-16
sp|Q660S1|GLYA_BORBP Serine hydroxymethyltransferase OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=glyA PE=3 SV=1 205 333 1.0E-16
sp|Q2JI36|GLYA_SYNJB Serine hydroxymethyltransferase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=glyA PE=3 SV=1 205 329 2.0E-16
sp|C1F3Q7|GLYA_ACIC5 Serine hydroxymethyltransferase OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=glyA PE=3 SV=1 209 333 2.0E-16
sp|B2VI25|GLYA_ERWT9 Serine hydroxymethyltransferase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=glyA PE=3 SV=1 202 330 2.0E-16
sp|Q47WY2|GLYA4_COLP3 Serine hydroxymethyltransferase 4 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=glyA4 PE=3 SV=1 209 317 2.0E-16
sp|A6VP23|GLYA_ACTSZ Serine hydroxymethyltransferase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=glyA PE=3 SV=1 209 326 4.0E-16
sp|B0TI64|GLYA_HELMI Serine hydroxymethyltransferase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=glyA PE=3 SV=1 209 329 5.0E-16
sp|A5FEF4|GLYA_FLAJ1 Serine hydroxymethyltransferase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=glyA PE=3 SV=1 202 334 5.0E-16
sp|B5Y8G6|GLYA_COPPD Serine hydroxymethyltransferase OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=glyA PE=3 SV=1 209 327 5.0E-16
sp|A6Q478|GLYA_NITSB Serine hydroxymethyltransferase OS=Nitratiruptor sp. (strain SB155-2) GN=glyA PE=3 SV=1 209 330 6.0E-16
sp|A5UI33|GLYA_HAEIG Serine hydroxymethyltransferase OS=Haemophilus influenzae (strain PittGG) GN=glyA PE=3 SV=1 209 330 6.0E-16
sp|Q4QM19|GLYA_HAEI8 Serine hydroxymethyltransferase OS=Haemophilus influenzae (strain 86-028NP) GN=glyA PE=3 SV=1 209 330 6.0E-16
sp|Q6D246|GLYA1_PECAS Serine hydroxymethyltransferase 1 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=glyA1 PE=3 SV=1 202 330 6.0E-16
sp|Q30P60|GLYA2_SULDN Serine hydroxymethyltransferase 2 OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=glyA2 PE=3 SV=1 209 330 7.0E-16
sp|Q3KDV1|GLYA1_PSEPF Serine hydroxymethyltransferase 1 OS=Pseudomonas fluorescens (strain Pf0-1) GN=glyA1 PE=3 SV=1 202 329 9.0E-16
sp|Q30R29|GLYA1_SULDN Serine hydroxymethyltransferase 1 OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=glyA1 PE=3 SV=1 219 330 1.0E-15
sp|Q5WB66|GLYA_BACSK Serine hydroxymethyltransferase OS=Bacillus clausii (strain KSM-K16) GN=glyA PE=3 SV=1 202 390 2.0E-15
sp|P43844|GLYA_HAEIN Serine hydroxymethyltransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=glyA PE=3 SV=1 209 330 2.0E-15
sp|Q31FS6|GLYA_THICR Serine hydroxymethyltransferase OS=Thiomicrospira crunogena (strain XCL-2) GN=glyA PE=3 SV=1 202 350 2.0E-15
sp|Q0VMH4|GLYA_ALCBS Serine hydroxymethyltransferase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=glyA PE=3 SV=1 209 321 2.0E-15
sp|B0BSL4|GLYA_ACTPJ Serine hydroxymethyltransferase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=glyA PE=3 SV=1 209 330 4.0E-15
sp|B3H053|GLYA_ACTP7 Serine hydroxymethyltransferase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=glyA PE=3 SV=1 209 330 4.0E-15
sp|A5CWI3|GLYA_VESOH Serine hydroxymethyltransferase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=glyA PE=3 SV=1 209 321 6.0E-15
sp|A5UDI4|GLYA_HAEIE Serine hydroxymethyltransferase OS=Haemophilus influenzae (strain PittEE) GN=glyA PE=3 SV=1 209 330 9.0E-15
sp|A6Q7H8|GLYA_SULNB Serine hydroxymethyltransferase OS=Sulfurovum sp. (strain NBC37-1) GN=glyA PE=3 SV=1 219 330 2.0E-14
sp|A3MYT3|GLYA_ACTP2 Serine hydroxymethyltransferase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=glyA PE=3 SV=1 209 330 2.0E-14
sp|Q7VFL1|GLYA_HELHP Serine hydroxymethyltransferase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=glyA PE=3 SV=1 220 330 2.0E-14
sp|Q2GHF1|GLYA_EHRCR Serine hydroxymethyltransferase OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=glyA PE=3 SV=1 220 330 9.0E-14
sp|Q057P9|GLYA_BUCCC Serine hydroxymethyltransferase OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=glyA PE=3 SV=1 209 329 2.0E-12
sp|A4VUM9|GLYA_STRSY Serine hydroxymethyltransferase OS=Streptococcus suis (strain 05ZYH33) GN=glyA PE=3 SV=1 209 390 5.0E-11
sp|A4W0W9|GLYA_STRS2 Serine hydroxymethyltransferase OS=Streptococcus suis (strain 98HAH33) GN=glyA PE=3 SV=1 209 390 5.0E-11
sp|B9DS48|GLYA_STRU0 Serine hydroxymethyltransferase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=glyA PE=3 SV=1 209 333 2.0E-10
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5081
MALDGQQQLLSAHLQKADPAVFEIIENEKRRQKHFINLIPSENFTSQAVLDALGSVMQNKYSEGYPGARYYGGNE
FIDQSERLCQHRALEAFDLDPKSWGVNVQALSGAPANLYVYSALMETHDRLMGLDLPHGGHLSHGYQTPTKKISF
ISKYFETLPYRLDESTGLIDYDKLEEMALVYRPKIIVAGASAYSRLIDYKRMREICDKANAYLLADAQSPDFHAY
QSQVLANAKAFAKRLGEEKSKGGLGYSIVSGGTDNHLVLADLKPNGIDGGRVERVLELVGVAANKNTVPGDRSAL
VPGGLRMGTPAMTTRGFNEDDFVRVADVVDRAVAITCRLDKAARAAAKDKGEKSPGKLKLFLDHLGNGDNEPEIV
QLRSEVEDWVGTYPLPWDSSK*
Coding >Hirsu2|5081
ATGGCCCTCGACGGCCAGCAGCAACTACTCTCTGCCCACCTCCAAAAGGCCGATCCTGCCGTCTTCGAAATTATC
GAGAATGAGAAAAGGCGGCAGAAGCACTTCATCAACCTGATTCCCTCGGAAAACTTCACCTCCCAGGCCGTCCTG
GACGCCCTCGGCAGCGTCATGCAAAACAAGTACTCTGAGGGCTACCCCGGTGCTCGCTACTACGGCGGCAACGAG
TTCATCGATCAGTCCGAGCGGCTCTGCCAGCATCGCGCCCTCGAGGCATTCGACCTGGACCCCAAGAGTTGGGGC
GTCAACGTTCAGGCCCTTTCCGGAGCTCCGGCCAACCTCTACGTCTACTCGGCCCTGATGGAGACGCACGACCGC
CTCATGGGCCTCGACCTGCCCCACGGCGGTCACCTGTCGCACGGCTACCAAACGCCGACCAAGAAGATCTCCTTC
ATCTCCAAGTACTTCGAGACGTTGCCGTACCGCCTCGACGAGTCCACCGGCCTGATCGACTACGACAAGCTCGAG
GAGATGGCCCTCGTCTACCGCCCCAAGATCATCGTCGCCGGCGCCAGCGCCTACAGCCGTCTGATCGACTACAAG
CGCATGCGCGAGATCTGCGACAAGGCCAACGCCTACCTGCTGGCCGACGCGCAGTCGCCCGACTTCCACGCCTAC
CAGTCGCAGGTGCTCGCCAACGCCAAGGCCTTCGCCAAGCGGCTGGGCGAGGAGAAGAGCAAGGGCGGGCTGGGC
TACAGCATCGTCTCGGGCGGCACCGACAACCACCTCGTCCTAGCCGACCTCAAGCCCAACGGCATCGACGGCGGC
CGGGTCGAGCGCGTGCTGGAGCTGGTCGGCGTCGCCGCCAACAAGAACACGGTGCCGGGCGACCGGTCGGCCCTG
GTCCCGGGCGGGCTCCGCATGGGCACGCCGGCCATGACGACGCGCGGCTTCAACGAGGACGACTTCGTGCGCGTC
GCCGACGTCGTCGACCGCGCCGTCGCCATCACCTGCCGCCTGGACAAGGCGGCGCGCGCCGCGGCCAAGGACAAG
GGCGAGAAGAGCCCGGGCAAGCTCAAGCTGTTCCTCGACCACCTGGGCAACGGCGACAACGAGCCCGAGATTGTG
CAGCTGCGGAGCGAGGTCGAGGACTGGGTCGGCACGTACCCGCTGCCGTGGGACTCGAGCAAGTGA
Transcript >Hirsu2|5081
ATGGCCCTCGACGGCCAGCAGCAACTACTCTCTGCCCACCTCCAAAAGGCCGATCCTGCCGTCTTCGAAATTATC
GAGAATGAGAAAAGGCGGCAGAAGCACTTCATCAACCTGATTCCCTCGGAAAACTTCACCTCCCAGGCCGTCCTG
GACGCCCTCGGCAGCGTCATGCAAAACAAGTACTCTGAGGGCTACCCCGGTGCTCGCTACTACGGCGGCAACGAG
TTCATCGATCAGTCCGAGCGGCTCTGCCAGCATCGCGCCCTCGAGGCATTCGACCTGGACCCCAAGAGTTGGGGC
GTCAACGTTCAGGCCCTTTCCGGAGCTCCGGCCAACCTCTACGTCTACTCGGCCCTGATGGAGACGCACGACCGC
CTCATGGGCCTCGACCTGCCCCACGGCGGTCACCTGTCGCACGGCTACCAAACGCCGACCAAGAAGATCTCCTTC
ATCTCCAAGTACTTCGAGACGTTGCCGTACCGCCTCGACGAGTCCACCGGCCTGATCGACTACGACAAGCTCGAG
GAGATGGCCCTCGTCTACCGCCCCAAGATCATCGTCGCCGGCGCCAGCGCCTACAGCCGTCTGATCGACTACAAG
CGCATGCGCGAGATCTGCGACAAGGCCAACGCCTACCTGCTGGCCGACGCGCAGTCGCCCGACTTCCACGCCTAC
CAGTCGCAGGTGCTCGCCAACGCCAAGGCCTTCGCCAAGCGGCTGGGCGAGGAGAAGAGCAAGGGCGGGCTGGGC
TACAGCATCGTCTCGGGCGGCACCGACAACCACCTCGTCCTAGCCGACCTCAAGCCCAACGGCATCGACGGCGGC
CGGGTCGAGCGCGTGCTGGAGCTGGTCGGCGTCGCCGCCAACAAGAACACGGTGCCGGGCGACCGGTCGGCCCTG
GTCCCGGGCGGGCTCCGCATGGGCACGCCGGCCATGACGACGCGCGGCTTCAACGAGGACGACTTCGTGCGCGTC
GCCGACGTCGTCGACCGCGCCGTCGCCATCACCTGCCGCCTGGACAAGGCGGCGCGCGCCGCGGCCAAGGACAAG
GGCGAGAAGAGCCCGGGCAAGCTCAAGCTGTTCCTCGACCACCTGGGCAACGGCGACAACGAGCCCGAGATTGTG
CAGCTGCGGAGCGAGGTCGAGGACTGGGTCGGCACGTACCCGCTGCCGTGGGACTCGAGCAAGTGA
Gene >Hirsu2|5081
ATGGCCCTCGACGGCCAGCAGCAAGTTCGTGGCCGGCATCACGGTTCCCTCTGGCACCTTGCAGACGCTGACAAC
CACAGCTACTCTCTGCCCACCTCCAAAAGGCCGATCCTGCCGTCTTCGAAATTATCGAGAATGTTCGACCCCTCC
CCCCGCCCGCTGCCATCCGATAGTCCGGCTCGAGACTGACGCCGCGTGCAGGAGAAAAGGCGGCAGAAGCACTTC
ATCAACCTGATTCCCTCGGAAAACTTCACCTCCCAGGCCGTCCTGGACGCCCTCGGCAGCGTCATGCAAAGTAGG
CTCCCGCGAAAGCCCCACCGAGCCGTACCAGTGCTGACGACGGCCGCACAAAGACAAGTACTCTGAGGGCTACCC
CGGTGCTCGCTACTACGGCGGCAACGAGTTCATCGATCAGTCCGAGCGGCTCTGCCAGCATCGCGCCCTCGAGGC
ATTCGACCTGGACCCCAAGAGTTGGGGCGTCAACGTTCAGGGTAGGCCGGCATGACGCGCGACTGCCCACGGCGT
ACTGACGTCGCCCAGCCCTTTCCGGAGCTCCGGCCAACCTCTACGTCTACTCGGCCCTGATGGAGACGCACGACC
GCCTCATGGGCCTCGACCTGCCCCACGGCGGTCACCTGTCGCACGGCTACCAAACGCCGACCAAGAAGATCTCCT
TCATCTCCAAGTACTTCGAGACGTTGCCGTACCGCCTCGACGAGTCCACCGGCCTGATCGACTACGACAAGCTCG
AGGAGATGGCCCTCGTCTACCGCCCCAAGATCATCGTCGCCGGCGCCAGCGCCTACAGCCGTCTGATCGACTACA
AGCGCATGCGCGAGATCTGCGACAAGGCCAACGCCTACCTGCTGGCCGACATGGCCCACATCTCGGGCCTCNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCCCCACAACCACACCAT
CACGGCCCTGGCCGTGGCGCTCAAGCAGGCGCAGTCGCCCGACTTCCACGCCTACCAGTCGCAGGTGCTCGCCAA
CGCCAAGGCCTTCGCCAAGCGGCTGGGCGAGGAGAAGAGCAAGGGCGGGCTGGGCTACAGCATCGTCTCGGGCGG
CACCGACAACCACCTCGTCCTAGCCGACCTCAAGCCCAACGGCATCGACGGCGGCCGGGTCGAGCGCGTGCTGGA
GCTGGTCGGCGTCGCCGCCAACAAGAACACGGTGCCGGGCGACCGGTCGGCCCTGGTCCCGGGCGGGCTCCGCAT
GGGCACGCCGGCCATGACGACGCGCGGCTTCAACGAGGACGACTTCGTGCGCGTCGCCGACGTCGTCGACCGCGC
CGTCGCCATCACCTGCCGCCTGGACAAGGCGGCGCGCGCCGCGGCCAAGGACAAGGGCGAGAAGAGCCCGGGCAA
GCTCAAGCTGTTCCTCGACCACCTGGGCAACGGCGACAACGAGCCCGAGATTGTGCAGCTGCGGAGCGAGGTCGA
GGACTGGGTCGGCACGTACCCGCTGCCGTGGGACTCGAGCAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail